KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1519Help
Entry
YE105_C1519       CDS       T01480                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:yep01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:yep00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1790519..1791844)
Genome map
AA seq 441 aa AA seqDB search
MQPTNFNTLIDWQQCSEEQQKALLSRPAINASERITATVSEILDRVKAEGDSALRDFSQR
FDTVQVADIRISSDEIVAAAGRLNDDIKQAMAQAVRNIEIFHNAQKMPVVDVETQPGVRC
QQITRPIASVGLYIPGGSAPLLSTVLMLGTPARIAGCQRVILCSPPPIADEILYAAQLCG
IQEVFQIGGAQAIAAMAFGSESVPKVNKIFGPGNAYVTEAKRQVSQRLDGAAIDMPAGPS
EVLVIADSGATPAFIASDLLSQAEHGPDSQVVLLTPDAAIAQAVAVEVEQQLKQLSRADI
ARQALESSRLIITKDLQQCIDISNQYGPEHLILQIRQPEDIIDKIDNAGSVFMGDWSPES
AGDYASGTNHVLPTYGYTSTYSSLGLADFVKRMTVQQLTPQGLLGLASTIETLAQAEQLT
AHKNAVTLRVAALTAAQKEQA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgacgaatttcaataccctaatcgactggcaacaatgcagcgaagagcaacaa
aaagcgctgttgagccgcccggctattaatgcttctgagcgaatcaccgcaacagtcagt
gaaatccttgaccgggtgaaagccgagggcgacagcgccttgcgtgattttagccaacgc
tttgataccgtgcaggtagctgatattcgcatcagtagcgatgaaatagtcgctgctgcc
gggcgtttgaatgacgacatcaagcaagctatggcgcaagcagtacgtaatattgaaatc
ttccacaacgcgcagaaaatgccagtggtggatgttgaaactcaaccgggcgtgcgttgc
cagcaaatcacccgcccgattgcttccgtcggcctgtatatccccggcggttctgctccg
ctactgtctaccgtcttgatgctcggcaccccagcgcgcattgccggttgccagcgcgtt
attttatgttctcctccgcctattgctgatgaaattctgtatgccgcgcaattgtgcggt
attcaggaagtgttccagattggtggcgcacaagcgattgctgcaatggcatttggcagc
gaatcagtgccgaaagtgaataaaatctttgggccgggcaatgcttacgtcacagaagca
aaacgtcaggtcagccaacgtttggacggtgccgcgatagatatgccagcgggcccatct
gaagtattggttatcgctgacagcggcgcgacaccggcatttattgcctcagacttgctg
tctcaggccgagcacggcccagactcacaagtggtattactgacaccagatgccgcgatt
gctcaggccgttgcggtcgaagttgagcaacaacttaagcagttgtcgcgcgctgacatt
gcccgacaggcactggaaagtagccgtttgatcatcaccaaagatttgcagcaatgtatt
gatatcagtaatcaatacgggccagagcacttgattctgcaaatacgccagccggaagat
attatcgataagattgataatgccggctcagtgtttatgggtgactggtcgccagaatca
gcgggtgactatgcctctggcaccaatcacgtattaccgacttatggttacacctcaacc
tattccagtttgggactggctgattttgttaagcgtatgaccgtgcagcaattaaccccg
caaggcttgctgggtctggcatcaaccatcgaaacgctggctcaggctgaacaactgacc
gcccacaaaaacgccgttaccctacgcgtcgctgccctaacagccgcccaaaaggagcaa
gcatga

DBGET integrated database retrieval system