KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1668Help
Entry
YE105_C1668       CDS       T01480                                 

Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YE105_C1668
  Lipid metabolism
   00600 Sphingolipid metabolism
    YE105_C1668
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    YE105_C1668
Enzymes [BR:yep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     YE105_C1668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1961410..1964562)
Genome map
AA seq 1050 aa AA seqDB search
MTAQQEVKPQATPALSQILFRRDWENPQITQYNRLEAHPPFYSWRHLDAAQNDTLSPQRQ
LLNGQWSFSYFTQPESVPDEWVDHDLPEAVSMPVPSNWQLHGYDIPIYTNVQYPIPVDPP
RVPQNNPTGCYSYNFTLEPDWLLSGQTRIIFDGVNSAFYLWCNGRWVGYSQDSRLPAEFD
LTPYLKAGNNRIAVLVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPDIHLRDIHISTHIS
PEFSSAHLEVMAAVNIPPLDINNSQVTRAYQIQVQLWLADSLVASLRQPLGTQPIDERGH
YTDRTHLSLRVEHPLLWSAEQPALYRAVVSLLDSQQKLIEAEAYDVGFRQVAIHQGLLKI
NGKAVLIRGVNHHEHHPQTGQAIDEESMLQDIILMKQHNFNAVRCSHYPNHPLWYRLCDR
YGLYVVDEANIETHGMQPMGRLADDPQWFSAFSERVTRMVQRDRNYPCIIIWSLGNESGH
GATHDALYRWIKTNDPTRPVQYEGGGANTQATDIVCPMYARVDEDQPFPAVPKWAIKKWI
GLPNESRPFILCEYAHAMGNSFGGFARYWQAFRQYPRLQGGFVWDWVDQSLTRNDENGQP
YWAYGGDFGDSPNDRQFCMNGLVFPDRTPHPSLYEAQCAQQFFQFSLVSTSPLIINVTSE
YLFRNSENEHLYWRIELAGKSVLEGSFPLDLLPESTQQFSLAERLPTISGPGDLWLNVEV
RQVEETPWSPSNHRCAWFQWRLPRSLAVLSRGLSDSATSNNLKFHQDTQHITVTHQQQHW
QFNRQTGLLEQWCVGGENRLLTPLRDQFVRAPLDNDIGISETTRIDPNAWVERWKKAGMY
QLEQRCLSLHADTLSQAIQISAEYIYEFAQEQLLHTHWLYRFDQQGRMTIDVRVQVATSL
PSLARVGMCCQLSDVYENVEWLGLGPHENYPDRQLSAQHSHWSQPLDQMHTPYIFPSENG
LRCNTSMLSYGNWQLTGQFHFGISRYSTQQLMAASHKHLLRSEAGTWLNIDGFHMGVGGD
DSWSPSVHADNLLTNEIYQYQVCWQYKDSI
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgacggcacagcaagaagttaaaccgcaggctacaccagccttatcacagattctgttt
cgcagggattgggaaaatccgcagataactcagtacaaccgcctggaagcacacccgcca
ttttacagttggcgtcatctcgatgcagctcaaaacgatacactttctccgcagcggcag
ttactcaatggacagtggtcattcagctattttacccaaccagaatccgtgccagatgaa
tgggttgatcacgatttaccagaagctgtatctatgccagtgccttccaattggcaactc
cacggttatgacatcccgatttatactaatgtgcaataccctattcccgtggatccacca
cgggtaccgcaaaataatccaaccggttgctattcatataattttaccttagagcctgac
tggctcttatcgggacaaactcgcattatttttgatggcgtgaattccgctttctatctc
tggtgcaacggccggtgggtcgggtattcccaagacagtcgcctacccgcggagtttgat
ctcacgccatatctgaaagctggaaataaccgtattgctgttctcgtattacgttggagt
gatggtagctatctggaagatcaggatatgtggcggatgagcggaattttccgcgatgtc
agcctactacacaaaccagatattcatttgcgggatattcacatctctacacatatatca
ccagaatttagctccgcacatttagaggtaatggccgccgttaacattcctccactcgat
attaataactcacaagtaacgagagcctatcaaatccaggttcagctctggctagcggat
tcgttagtcgccagtttacgacagcccctgggtactcaaccaattgacgagcgaggccat
tataccgatcgcactcatctaagcttgcgagtagagcatcctttattatggagcgcagaa
caacctgcgctatatagagctgtcgtctcgctactggatagtcagcaaaaactgatagaa
gcagaagcctatgatgttggcttcaggcaagtcgccattcatcaaggtttgctcaaaatc
aatggcaaagcggtactgattcgaggggtgaatcatcatgaacatcacccacaaacaggg
caagctattgatgaagaaagtatgctgcaagatattattctgatgaaacagcataacttt
aatgccgtacgctgctcacattatcccaaccatccgctatggtaccgcctgtgcgatcgc
tatggtttatatgttgtcgatgaagccaacattgaaactcatgggatgcaacctatgggg
cggttggcagatgatccacagtggttttccgcttttagcgaacgagttacgcggatggtt
cagcgtgatcgtaactacccttgcattattatctggtcgttgggtaacgaatctggtcat
ggtgccacacacgatgcactctatcgttggataaaaaccaatgaccccacgcgcccggta
caatatgaggggggtggtgcgaatactcaggctaccgatattgtttgccccatgtatgcc
cgcgtagatgaggatcaaccttttccagcggtgcctaagtgggccattaagaaatggatt
ggtctaccgaatgaatctcgcccatttattttgtgtgaatacgcccatgctatggggaac
agttttggtggatttgcccgctattggcaagcgtttcgccaatatccccgactacaaggt
ggattcgtttgggattgggtcgaccaaagccttacccgtaatgatgaaaatggtcagcct
tattgggcttatggcggagactttggcgatagccccaatgatcgccaattctgcatgaat
gggttagttttcccagaccgtacccctcaccccagtttgtatgaggcgcaatgcgcgcag
cagttcttccaattctcattggttagtacctcaccgctgataatcaatgtaaccagtgaa
tacctgttcagaaacagcgagaacgaacatctatactggcgcatcgagttagcgggtaaa
tcagttctggaagggagtttcccgctagacctattacctgaaagcacacaacaattcagc
ctagccgagcgattacccactatcagtgggcctggtgatttatggttgaatgttgaggtt
agacaggtagaagagacaccatggtcaccaagtaatcatcgttgcgcctggttccaatgg
cgtttaccacgttctttagcggtcttaagtcgcggcttaagtgattcagctacgtccaat
aacctcaagttccaccaagatacacagcatattacggtgacccatcagcaacaacactgg
caatttaatcgtcaaaccggattacttgaacaatggtgtgtcggtggggaaaacaggtta
ctgaccccattgcgagatcaatttgttcgtgcgccgctagataacgatattggcatcagt
gaaacaacgcggattgatccaaatgcttgggttgaacgctggaaaaaagctggaatgtat
caactggagcaacgttgtttatcattacatgcagatacattgtctcaggcaatacaaatc
agcgcggaatatatctacgagtttgcccaagagcaattattacatactcattggttatac
cgttttgatcaacaaggacgcatgactattgatgtccgagtccaagtagcaacttcacta
ccctctttagcaagagtcggcatgtgttgccagttatctgatgtttatgaaaatgttgag
tggttagggttaggacctcacgaaaactatcctgatcgtcagctatcggcacagcatagt
cattggtcgcaaccacttgaccaaatgcatactccctacatattccccagtgaaaatggg
ctacgttgcaacaccagtatgttgagttatggaaattggcagttaacaggtcaattccat
tttggcatcagccgttacagtactcagcaacttatggcagccagccataagcatttactt
agatcagaagcaggtacctggctaaatatagatggtttccatatgggggtgggtggtgat
gactcatggagccctagcgtccatgctgataacttactgactaatgagatttatcaatat
caagtctgttggcaatacaaagactcaatctga

DBGET integrated database retrieval system