KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1686Help
Entry
YE105_C1686       CDS       T01480                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:yep00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    YE105_C1686
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    YE105_C1686
Enzymes [BR:yep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     YE105_C1686
Two-component system [BR:yep02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   YE105_C1686
Bacterial motility proteins [BR:yep02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    YE105_C1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1987376..1988425
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLCVDDSALMRQLMTEIINSHPDMEMVAAAPDPLVARDLIKKFNPQVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKNSEITMRALELGAIDFVTKPQLGIREGMLAYS
ELIAEKIRTAAKARLPQRGPEHAPVMLTHTPLLSSEKLIAIGASTGGTEAIRTVLQPLPP
TSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEDGERVLPGHAYIAPGDRHMELARSG
ANYQVRIHDGPAVNRHRPSVDVLFRSVAQYAGRNAVGVILTGMGNDGAAGLLEMHRAGAY
TIAQNEASCVVFGMPREAIGMGGVNEILDLNQISQRMLAQISSGQALRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagagtattgtgcgttgatgattccgcgttaatgcgccagttaatgaca
gagattattaacagtcacccagatatggaaatggttgcagcagcacctgatccgttggtt
gcccgtgatttgattaaaaaatttaatccgcaggtattaacactcgatgttgaaatgcca
cggatggatggtttggattttcttgagaaattaatgcggttacggccgatgccggtagtg
atggtttcatcattaaccggaaaaaactcagagataaccatgcgcgcgctggaattgggg
gctatcgattttgtcaccaaaccgcagttgggtatccgagaagggatgctggcttacagc
gagttgattgcggagaaaatccgcacggccgcgaaagctcgtttgccacagcgcggcccg
gaacatgcaccggtgatgctgacgcatacgccgttgctcagcagtgagaaactcattgcg
atcggcgcatcgacggggggaactgaagccatccgtaccgtgttacaacctttgcctccg
accagtccggcattgttgataacacagcatatgccaccgggttttacccgttcatttgca
gagcggctcaataaattgtgccaaattaccgtgaaggaagcagaagacggtgagcgggta
ttgcccggacacgcctatattgcacccggtgatcggcacatggaattggcgcgcagtggg
gcaaactatcaggtgcgtattcatgatgggcctgcggttaatcgccatcgcccctcggtt
gatgtgcttttccgttcagtggcgcagtatgccgggcgcaatgcggtcggtgtcattctg
acgggaatgggtaatgacggtgcagccggcttactggagatgcatcgggcaggggcttat
accattgcacaaaacgaagccagttgtgtggtcttcgggatgccgcgtgaagctattggg
atgggcggcgttaatgaaatcttggatttgaaccagataagtcagcgcatgttggcacag
ataagcagcggtcaagccctgcgaatctaa

DBGET integrated database retrieval system