KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1738Help
Entry
YE105_C1738       CDS       T01480                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YE105_C1738
Enzymes [BR:yep01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     YE105_C1738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2040731..2041723
Genome map
AA seq 330 aa AA seqDB search
MTLQHKLAQFPRLDLVGNATPLEKLSRLSDYLGREIYIKRDDVTPLALGGNKLRKLEFLA
ADALRQGADTLVTAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTSQENYLTNGNRLLL
DLFNVEVVMCDGLHDPNRQLAELATRIEAQGFRPYVVPVGGSNALGALGYVQCALEIAAQ
SAGNVTFSSVVVASGSAGTHAGLAVGLQQLLPQTELIGVTVSRKAEEQRPKVTHIQQELA
TSLGVTSGPADITLWDDYFAPQYGMPNEEGLAAIGLLARLEGILLDPVYTGKAMAGLLDG
LEQKKFRDDGPILFIHTGGAPALFAYHPQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcttcaacataaactggcgcaatttccgcgcctggatttggtcggtaatgccacg
ccattagagaaactatctcgtctttctgactatttgggacgcgaaatctatattaaacgt
gatgatgtcacacccttggcacttggcggcaataagctgcgtaagctggagtttttagcg
gctgatgcgttgaggcaaggagcggatacactggtgaccgcaggggctatccaatctaat
catgtgcgccaaacagcggctgttgctgcaaaattgggcttacattgtgttgcgttactt
gagaatcctatcggtacctcacaggagaattatttgaccaatggcaatcgattgctgttg
gatttatttaatgttgaggtggtgatgtgcgatggattacatgatccaaaccggcaattg
gctgagttggcaacccgcatcgaggcgcagggatttcgcccttatgtggtgccggttggt
gggtctaatgctttaggggccttgggatatgtgcaatgtgcattggaaattgcagctcaa
tcggctggaaatgtcacctttagctcagtggttgtggcttcgggcagtgcgggtacccat
gcggggttggctgtcggtttacagcaactgttgccgcaaacggagctgattggtgtcaca
gtatcgcgcaaagcagaagaacagcgccctaaagttactcatattcaacaagaattagcg
acatccctcggcgtgaccagcgggcctgcggatatcaccctatgggatgattattttgcg
ccgcaatatggtatgccaaatgaagaagggctggcggcaatcgggttattggcaaggctg
gaaggaatattgctggacccggtttataccggcaaggcaatggctggtttacttgatggc
cttgagcagaaaaagtttcgcgatgatggccccattttgtttattcatactggcggcgca
cctgcattatttgcttatcatccgcaggtgtag

DBGET integrated database retrieval system