KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1738Help
Entry
YE105_C1738       CDS       T01480                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:yep00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2040731..2041723
Genome map
AA seq 330 aa AA seqDB search
MTLQHKLAQFPRLDLVGNATPLEKLSRLSDYLGREIYIKRDDVTPLALGGNKLRKLEFLA
ADALRQGADTLVTAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTSQENYLTNGNRLLL
DLFNVEVVMCDGLHDPNRQLAELATRIEAQGFRPYVVPVGGSNALGALGYVQCALEIAAQ
SAGNVTFSSVVVASGSAGTHAGLAVGLQQLLPQTELIGVTVSRKAEEQRPKVTHIQQELA
TSLGVTSGPADITLWDDYFAPQYGMPNEEGLAAIGLLARLEGILLDPVYTGKAMAGLLDG
LEQKKFRDDGPILFIHTGGAPALFAYHPQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcttcaacataaactggcgcaatttccgcgcctggatttggtcggtaatgccacg
ccattagagaaactatctcgtctttctgactatttgggacgcgaaatctatattaaacgt
gatgatgtcacacccttggcacttggcggcaataagctgcgtaagctggagtttttagcg
gctgatgcgttgaggcaaggagcggatacactggtgaccgcaggggctatccaatctaat
catgtgcgccaaacagcggctgttgctgcaaaattgggcttacattgtgttgcgttactt
gagaatcctatcggtacctcacaggagaattatttgaccaatggcaatcgattgctgttg
gatttatttaatgttgaggtggtgatgtgcgatggattacatgatccaaaccggcaattg
gctgagttggcaacccgcatcgaggcgcagggatttcgcccttatgtggtgccggttggt
gggtctaatgctttaggggccttgggatatgtgcaatgtgcattggaaattgcagctcaa
tcggctggaaatgtcacctttagctcagtggttgtggcttcgggcagtgcgggtacccat
gcggggttggctgtcggtttacagcaactgttgccgcaaacggagctgattggtgtcaca
gtatcgcgcaaagcagaagaacagcgccctaaagttactcatattcaacaagaattagcg
acatccctcggcgtgaccagcgggcctgcggatatcaccctatgggatgattattttgcg
ccgcaatatggtatgccaaatgaagaagggctggcggcaatcgggttattggcaaggctg
gaaggaatattgctggacccggtttataccggcaaggcaatggctggtttacttgatggc
cttgagcagaaaaagtttcgcgatgatggccccattttgtttattcatactggcggcgca
cctgcattatttgcttatcatccgcaggtgtag

DBGET integrated database retrieval system