KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1826Help
Entry
YE105_C1826       CDS       T01480                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00900  Terpenoid backbone biosynthesis
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
yep01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YE105_C1826
Enzymes [BR:yep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     YE105_C1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADZ42322
Position
complement(2117856..2118737)
Genome map
AA seq 293 aa AA seqDB search
MANTNQYVWPSPAKLNLFLYITGQRADGYHLLQTLFQFLDYGDELTIVPRNDDQIRLLTP
IVGVENEQNLIIRAARLLQQHPCSAKVPRGADISIDKRLPMGGGLGGGSSNAATVLVALN
TLWHCGLSDEELAALGLTLGADVPVFVRGHAAFAEGIGEKLHPAEPIEKWYLVVHPGVNI
PTPIIFSDPELKRNTPIRPLAALLSAPYANDCEPIARKRFREVEQALSWLLEYAPSRLTG
TGACVFAEFDTESSARQVLSIAPEWLHGFVARGVNLSPLHRVRSGKMENSEHR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcgaataccaatcaatacgtctggccgtcacccgctaaattgaatttgtttctttat
atcaccgggcaacgcgctgatggctatcacctattacagactttgttccagtttctcgat
tatggcgatgaactgacgattgtgccccgcaatgacgatcagattcggctattaactccc
attgtcggggtggaaaacgaacaaaacctgataatccgcgcggcacgattgctgcaacaa
catccctgctcagcaaaagtacctcggggggcggatattagcatcgataaacgcttgcca
atgggtggcggtttgggtggcggttcgtccaatgcagcaacggtgctagtcgcactcaat
accctgtggcactgtggtctgtctgatgaagaattagccgctcttggactcacattgggg
gccgatgtaccggtatttgttcgcggtcatgcagcctttgccgagggaattggtgaaaag
ttgcaccccgcagagcctatagagaagtggtatttggtggttcaccccggagtaaacatc
ccaacacccattattttttccgatcctgaattaaaaagaaatacgccaattcgcccactg
gcggcgcttttaagcgctccgtacgcaaatgattgcgaaccaatcgcaagaaaacgtttt
cgcgaggttgaacaggctctttcatggctgttagaatatgccccgtcacgcctgaccgga
accggagcttgtgtctttgcagaatttgacacggagtcatcggcccggcaggtgttaagt
attgccccggagtggttgcacggttttgttgcccgtggagtgaacctttcgccactgcat
cgcgtacgctctgggaaaatggaaaacagtgagcacagataa

DBGET integrated database retrieval system