KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1896Help
Entry
YE105_C1896       CDS       T01480                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:yep03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2197831..2198448
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETNGVGYEVQLPMTCFYELPDIGQEAIIFTQFVVREDAQLL
YGFNDKQERALFRELIKVNGVGPKLALAILSGMSAQQFVAAVEREDITTLVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNNIGDIQLPASNSSQISEADIEAEAASALVALGYKPQEAS
RLVSKIAKPGADCEALIRDALRAAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgatagggcgcctcagaggtatcattctggaaaaacagccacccttggtgctgctggaa
actaacggtgttggctatgaagtccaactacctatgacctgtttttatgagctgccagat
attgggcaggaagccattatctttacccagtttgtggtacgcgaagatgctcagctacta
tacggttttaatgataagcaggaacgagcactgtttcgtgaattaataaaagtgaacggt
gtggggccaaaactggcgctggccattctttctggaatgtcggcgcaacagtttgtagcc
gcggttgaacgcgaagatattaccaccttggtaaaattaccgggggtcggcaagaagacc
gctgagcggttagtggttgaaatgaaagaccgctttaaaggcctcaatggtgacttgttt
aacaatatcggtgatattcagttgcctgccagcaattcgtcacaaatctcagaagccgat
attgaagcggaagccgcttctgcgctggtagctttgggctataaaccacaagaagctagc
cgcctggtgagtaaaatagctaaaccgggtgcagattgtgaagctttgatccgtgatgct
ttgcgtgccgcgttatag

DBGET integrated database retrieval system