KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1999Help
Entry
YE105_C1999       CDS       T01480                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    YE105_C1999
  Metabolism of other amino acids
   00480 Glutathione metabolism
    YE105_C1999
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     YE105_C1999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2303875..2304429
Genome map
AA seq 184 aa AA seqDB search
MSHSIYSIPVKTIESQSVNLGKYKGSVLLVVNVASQCGLTKQYEGLENLYKTYQQQGFEV
LGFPSNEFAGQEPGSDEEIQAFCRGTFGVDFPMFSKIEVNGPQRHPLYQHLIAAKPVAVK
PEGSEFYQRLASKGREPKHAGDILWNFEKFLIGRDGTVLERFAPDMTPEDPILVNAITRA
LAAH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtcattcaatttattccatcccagtaaaaacgattgaaagccaatccgttaacctg
ggaaagtataaaggatcggttttgctggtggtcaatgtggcttcccaatgtggtttaacc
aagcagtatgaagggttggaaaatctatacaaaacatatcagcaacagggttttgaagta
ttgggctttccaagcaatgagtttgcgggtcaagagcccggcagcgatgaggaaatccag
gcattttgtcgtggaacttttggtgtcgatttcccgatgttcagcaaaatagaagttaat
ggcccacaacggcatcctttataccaacatctaatcgcggccaaacctgtggcggtaaaa
cctgaaggtagtgagttctatcagcgcttagcaagtaaaggtcgtgagccaaaacatgcc
ggtgacattctgtggaactttgaaaaattcttgattggccgagatggtacggttcttgaa
agatttgcacccgatatgacgccagaagacccgattttggtcaatgctattacacgcgca
ttggctgctcactaa

DBGET integrated database retrieval system