KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1999Help
Entry
YE105_C1999       CDS       T01480                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:yep00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:yep00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2303875..2304429
Genome map
AA seq 184 aa AA seqDB search
MSHSIYSIPVKTIESQSVNLGKYKGSVLLVVNVASQCGLTKQYEGLENLYKTYQQQGFEV
LGFPSNEFAGQEPGSDEEIQAFCRGTFGVDFPMFSKIEVNGPQRHPLYQHLIAAKPVAVK
PEGSEFYQRLASKGREPKHAGDILWNFEKFLIGRDGTVLERFAPDMTPEDPILVNAITRA
LAAH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtcattcaatttattccatcccagtaaaaacgattgaaagccaatccgttaacctg
ggaaagtataaaggatcggttttgctggtggtcaatgtggcttcccaatgtggtttaacc
aagcagtatgaagggttggaaaatctatacaaaacatatcagcaacagggttttgaagta
ttgggctttccaagcaatgagtttgcgggtcaagagcccggcagcgatgaggaaatccag
gcattttgtcgtggaacttttggtgtcgatttcccgatgttcagcaaaatagaagttaat
ggcccacaacggcatcctttataccaacatctaatcgcggccaaacctgtggcggtaaaa
cctgaaggtagtgagttctatcagcgcttagcaagtaaaggtcgtgagccaaaacatgcc
ggtgacattctgtggaactttgaaaaattcttgattggccgagatggtacggttcttgaa
agatttgcacccgatatgacgccagaagacccgattttggtcaatgctattacacgcgca
ttggctgctcactaa

DBGET integrated database retrieval system