KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2029Help
Entry
YE105_C2029       CDS       T01480                                 

Definition
(GenBank) multidrug efflux protein
  KO
K03327  
multidrug resistance protein, MATE family
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Transporters [BR:yep02000]
 Solute Carrier Family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   YE105_C2029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2340990..2342363)
Genome map
AA seq 457 aa AA seqDB search
MQKYIVEARSLLALAIPVVIAQLSQTAMGVVDTIMAGSVSATDMAAVAVGTSIWLPAILF
GHGLLLALTPTVAQLNGSGRRNQIAHQVRQGFWLAFCVSVLIMVVIYNSDHIIMRMHNID
PVLADKAVGFLHAIMWGAPGYLFFQVLRNQCEGLSKTKPGMVIGFIGLLVNIPINYIFIY
GKLGAPALGGVGCGVATGTVYWVMFLMMRWYVTRARSQQDIKLEKGFAAPDWQVMKRLGG
LGLPVALALFFEVTLFAVVALLVSPLGIVAVAGHQIALNFSSLMFMLPMSLSVAATIRVG
FRLGQGSVDDARVAAYTSIAVGLMLACVTAIFTVVFREHIALLYNKTPEVVVMASHLMLL
AALYQLSDAIQVIGSGVLRGYKDTRSIFFITFTAYWLLGLPSGYLLGLTDYVVPAMGPSG
FWIGFVIGLTSAAILMVLRIRWLQKQPSAFILQKAAH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagtatatcgtcgaagcgcgtagcttgttggctctcgctattcctgttgttatc
gcgcaattgtcccaaaccgccatgggtgtggttgacactattatggccggttctgtcagt
gcaaccgatatggctgcggtggcggtggggacctcaatctggttaccggctatcttattt
ggtcacggattattgttggcgttgacgccgacagttgctcaacttaatggctccgggcgg
cgcaaccaaattgctcatcaggtcagacagggcttttggctggcattctgtgtctcggta
ttaatcatggtggtcatctataatagcgaccacatcattatgcgcatgcataatattgat
ccggtactggcagataaagccgttggtttcctgcatgccattatgtggggcgcgccaggc
tatctcttctttcaggtgctacgcaatcagtgtgaagggctatccaaaaccaaacctggg
atggtgattggatttattggtttactggttaacattcccattaactatattttcatctac
ggtaaattgggtgctccagcattaggcggtgtcggttgcggggtggcaaccggaacggtt
tattgggtgatgttcttaatgatgcgttggtatgtgacgcgcgcgcgctcacagcaagat
atcaaactggaaaaaggatttgctgcaccggactggcaagtcatgaaacgcctcgggggc
cttgggctgccggttgcgctggcgctgtttttcgaagtgaccttatttgcggttgtcgca
ttactggtttctccgctgggtattgtcgcggtggctgggcaccagattgccctcaacttt
agttcattgatgtttatgttaccgatgtcattgagtgtcgccgcgaccattcgtgtcggt
tttcgtcttggtcaaggttcggttgacgatgccagagtggctgcttataccagtattgct
gtgggtttaatgttggcgtgtgtcaccgcgatatttactgtggtatttcgcgaacatatc
gcgctgctttataacaagacacctgaagtggtggtaatggcctcacacttaatgttattg
gcagcactttaccaattgtctgatgcgattcaggtgatcggcagcggcgtattacgcggt
tataaagatacccgctctatcttctttattaccttcaccgcctactggttgttggggcta
ccgagtggttatttactcggtttgaccgattatgttgtgccagcgatggggccaagtggt
ttctggatcgggttcgttatcggcctgacctcggcagctatactgatggtgctgcgcatc
cgctggttacaaaagcagccatctgcttttattctgcaaaaagcggcacactaa

DBGET integrated database retrieval system