KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2033Help
Entry
YE105_C2033       CDS       T01480                                 

Definition
(GenBank) putative DNA-binding transcriptional regulator
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2346418..2347356
Genome map
AA seq 312 aa AA seqDB search
MWSEYALDVVDAVARTGSFSAAAQELHRVPSAISYTVRQLEEWLAVPLFTRRHRDVELTE
AGKVFIKESRDVIKKMNDTRRQCQQVANGWRGQLNIVVDKIVKPQRSRRLVLDFYRHFPD
IELRVRYEVFNGVWDVLADGQADMAIGATRAIPVGGRFVFRDMGFLTWHCVVSINHPLAQ
LTGPLNDDQLRPYPSLCLEDTARNLPKRDTWTLDNQQRLVAPDWATGIDCLCEGLCIGMV
PAHMVSPLIAQGKLAALTLADPLPASPCCLTWEQNNHSPALAWMLEYLGDSVTLNDEWLR
DDNGTDNELRQN
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcagaatacgcattggatgtggtggatgctgttgcacgcaccgggagtttcagc
gctgctgcgcaagaattacaccgcgtaccgtctgcgataagttataccgtgcgtcaattg
gaggagtggttggctgtgccgctatttacgcgacgccatcgggatgtcgaattgaccgaa
gcaggcaaagtttttattaaagaatcgcgtgatgttatcaaaaaaatgaatgacacacgt
cgtcaatgtcaacaagtggcgaatggctggcgcgggcaattaaatatcgtggtcgataaa
atcgtcaaacctcagcgaagccgccgtttagtgctggatttttatcgccattttcccgat
atcgaattgcgggtgcgctatgaagtcttcaacggcgtttgggatgtgctggcggatgga
caagcggatatggccattggtgcgactcgtgccatcccagttggcgggcggtttgtcttt
cgtgacatgggttttctgacctggcattgcgtagtcagtatcaatcaccctttagcgcag
ctaaccgggccacttaacgacgatcagttgcggccttatccctctctctgtttagaggat
actgcgcgaaatttgccgaaacgagatacctggacgttggataaccaacagcgattagtg
gcaccggattgggcgacgggcatagactgtctgtgtgaggggttatgtattggcatggtg
cccgctcatatggtatcgcccctgattgcacaagggaaactggcagccttaacacttgct
gaccccttacctgctagcccgtgttgcttgacgtgggagcagaataaccattccccggcc
ttagcctggatgctggaatatttgggtgacagtgtcacgttaaatgatgagtggctaaga
gatgataatggcacggataatgagcttcggcagaattag

DBGET integrated database retrieval system