KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2036Help
Entry
YE105_C2036       CDS       T01480                                 

Definition
(GenBank) hypothetical protein
  KO
K19303  
murein DD-endopeptidase [EC:3.4.-.-]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Enzymes [BR:yep01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     YE105_C2036
Peptidases [BR:yep01002]
 Cysteine Peptidases
  Family C40
   YE105_C2036
Peptidoglycan biosynthesis and degradation proteins [BR:yep01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   YE105_C2036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2349773..2350663)
Genome map
AA seq 296 aa AA seqDB search
MRLILTLFVLLFTQLFLNLAHASPQAHVSAEQKKGQVSQASPDDRKKRKADKNTKKTKID
NNKTNSKNVTNKIATNNDKKKTVATASKTIKKKAQEVSKPTRQKVTSRKKTNIKTASNKK
AAVKKTEKVAYGRHRNKTQGKAATELVANSKIKLSPAHKKRYQHAKQTAMSKLMKQVGKP
YRWGGTSPNTGFDCSGLIYYAYKDVIRIKMPRTANEMYHLRDAAPVKRAELESGDLVFFN
IANRGVADHVGVYLGNGKFIQSPRTGEEIRISMLDNDYWQDHYVGARRVVTPKTIR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttaatacttacgctgtttgtgctgctgtttacccagctatttctaaacctcgca
catgcgtcgccgcaggctcacgtctcggctgagcaaaaaaagggccaagtcagtcaggcc
agtcctgatgaccgtaaaaaacgtaaagctgataaaaatactaaaaaaaccaaaattgat
aacaacaaaaccaatagtaaaaatgtgacaaataaaatagcgaccaataacgataaaaag
aaaacggtagctaccgccagcaaaaccattaagaaaaaggcacaggaagtcagtaaaccc
acccgccaaaaagtcactagtcgcaaaaaaacgaatattaaaactgctagcaataaaaaa
gcggcagttaaaaaaaccgaaaaagtggcttacggtcgccatcgcaataaaacccaaggt
aaagccgcgaccgaattagtagcaaacagtaaaataaaactcagccctgcgcataaaaaa
cgctaccagcatgctaaacagaccgcaatgagcaaactaatgaagcaagtggggaaacct
tatcgctggggtggcacctcccctaataccggttttgattgcagcgggcttatttactac
gcctataaagatgtcatcagaataaaaatgccacgtactgctaatgaaatgtatcatttg
cgcgatgcagcaccggttaaacgcgctgaattagaaagtggtgatttagtgttcttcaat
attgctaatcgcggtgttgctgatcatgtcggcgtttatttaggcaacggcaaatttatt
cagtcaccacgcaccggtgaagaaattcgtattagcatgctagacaacgactactggcaa
gatcattatgtcggcgctcgtcgtgttgtgacaccgaaaactatccgctaa

DBGET integrated database retrieval system