KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2038Help
Entry
YE105_C2038       CDS       T01480                                 

Definition
(GenBank) ribonuclease T
  KO
K03683  
ribonuclease T [EC:3.1.13.-]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Enzymes [BR:yep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     YE105_C2038
Transfer RNA biogenesis [BR:yep03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    YE105_C2038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2351516..2352214)
Genome map
AA seq 232 aa AA seqDB search
MRAEFDEDKKLMADKSDLNALSGRFRGYYPVVIDVETAGFNAQTDALLEIAAVTLQMNKD
GWLLPDETLHFHVDPFEGANLEPEALAFNGIDPTNPLRGAVSEHDALHAIFKAVRKGLKE
QGCNRAIIVAHNAHFDHSFVMAAAERASLKRNPFHPFATFDTAALSGLVLGQTVLAKACL
TAGIPFDSSQAHSALYDTMQTAKLFCELVNRWKKLGGWPVPAGESEQPNSSQ
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgaattcgatgaagataagaaactgatggcagataaaagtgaccttaacgcc
ctgagtggccgttttcgtgggtattatcccgtagtaattgatgtagaaaccgccggtttt
aatgctcaaactgacgcattattagagattgctgccgtcaccttgcaaatgaacaaggac
ggttggctgctgcctgatgaaacgctacattttcatgtagatccgttcgaaggtgctaat
ctggaacccgaagcgctggcatttaatggaatagaccccaccaatccattacgtggtgca
gtgagtgaacatgatgcgttacatgctattttcaaagctgtgcgcaaagggttgaaagaa
caaggctgtaaccgcgccattatcgtcgcgcataatgctcattttgatcacagctttgtg
atggccgcggcagaacgcgccagcttgaagcgtaacccgttccacccatttgccactttc
gacaccgcagcacttagtgggctggttttggggcaaaccgtattggcaaaagcttgcctg
acggcaggtattccgtttgatagcagccaagctcactctgctttgtacgatacaatgcaa
acggcgaaattattctgtgagttggtcaatcgttggaagaaattgggtggctggccggta
ccggcgggtgaatctgagcaacctaactcaagtcaataa

DBGET integrated database retrieval system