KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2040Help
Entry
YE105_C2040       CDS       T01480                                 

Definition
(GenBank) N-ethylmaleimide reductase
  KO
K10680  
N-ethylmaleimide reductase [EC:1.-.-.-]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    YE105_C2040
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     YE105_C2040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2352879..2353976)
Genome map
AA seq 365 aa AA seqDB search
MKTAKLFSPLKVGALTLPNRVFMAPLTRLRSIEPGDIPTPLMAEYYRQRASAGLIITEAT
QISFQAKGYAGAPGLHTQEQLNAWKKITQAVHDEGGHIAVQLWHVGRISHNSLQPDQQAP
VAPSAIAADTRTTVRDETGAWVRVPCSTPRALETEEIPGIINDFRQATANAREAGFDYIE
LHAAHGYLLHQFMSPASNQRTDQYGGSIENRTRLTLEVVDATAAEWGAERIGIRISPLGP
FNGLDNGEDQEEAALYLIEELNKRHIAYLHISEPDWAGGKPYSDAFRDAVRARFKGVIIG
AGAYTAEKAENLIEKGFIDAVAFGRSYISNPDLVERLQQDAPLNEPDGETFYGGGAKGYT
DYPKL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgctaaactgttctcccctttgaaggttggcgcgctcactttgccaaaccgt
gtatttatggctccactgacgcgtttacgtagtattgagccaggtgatattcctactccg
ttaatggctgaatattatcgtcaacgcgccagtgcaggtttgattatcactgaagcgact
cagatttctttccaggcgaaaggctacgctggcgctccggggttgcacactcaagagcag
ttaaacgcctggaaaaaaatcacgcaagctgtgcatgatgaaggtggacatattgccgtg
caactgtggcatgtgggccgtatttcacacaacagtttacagccagaccaacaagcacct
gttgcgccatctgccattgccgcagatactcgcaccaccgttcgtgatgaaacaggtgcc
tgggttcgtgttccctgctctacgccgcgcgcactggaaacagaagagatccctggcatc
attaatgatttccgccaggcaacagccaatgcccgtgaggctggatttgattatattgaa
ttgcatgcggcccacggctatttattacatcaatttatgtctccggcatcaaaccagcgt
actgaccaatacggtggcagcattgaaaaccgaactcgcctgaccttagaagtggttgat
gccacagcggctgaatggggcgctgagcgtattggtatccgtatttcacctttaggcccg
ttcaatggtttggataatggtgaagatcaggaagaagcggcgctgtatctgattgaagaa
ttaaacaaacgccatatcgcttatctgcacatttccgagccagactgggctggcggtaaa
ccttattcagatgcattccgcgatgctgtgcgtgcccgcttcaaaggggtgattatcggc
gcaggtgcttataccgcagaaaaagccgaaaacctgattgagaaaggatttattgatgcc
gttgcctttggccgcagctatatttccaacccagatctggttgagcgtttgcagcaagat
gcaccactgaatgagcctgacggtgaaaccttctacggtggcggcgctaagggctatacc
gactatccaaagctgtaa

DBGET integrated database retrieval system