KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2051Help
Entry
YE105_C2051       CDS       T01480                                 

Definition
(GenBank) putative lipoprotein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2363935..2364234
Genome map
AA seq 99 aa AA seqDB search
MKYLFGTTAVLMLTGCSLVQPKNETLHYQCGGTKLTVMQDNKQDKVSLVLDGKQLILPQV
RAASGAKYSDNHYTFWSKGNTAFVERDDKVIINDCMLIK
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatctatttggcacgacggcagtattgatgctgacaggatgcagtttggtgcag
ccaaaaaacgaaactttgcattaccaatgtggtggtaccaagctaacggtaatgcaagat
aataagcaggataaagtcagtttagtgctagacggcaaacagcttatcttgccgcaagtt
cgtgccgcttccggggcaaaatacagtgataatcactatactttctggtcgaagggcaat
acagcttttgttgagcgagacgataaagtcattatcaatgactgtatgttgataaaataa

DBGET integrated database retrieval system