KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2052Help
Entry
YE105_C2052       CDS       T01480                                 

Definition
(GenBank) pyridoxamine 5'-phosphate oxidase
  KO
K00275  
pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YE105_C2052
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.5  pyridoxal 5'-phosphate synthase
     YE105_C2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2364342..2364995
Genome map
AA seq 217 aa AA seqDB search
MTDNNEFDVADLRREYIRGGLRRSDLTENPLGLFERWLKQACDARLPDPTAMCVATVDAN
GQPYQRIVLLKHYDDQGLVFYTNLGSRKAQQLAQNPHISLLFPWHMLDRQVIFLGTAERL
STLEVLKYFSSRPKDSQIGAWVSQQSSRISARGVLESKFLELKQKFQQGDVPLPSFWGGF
RVKFDSVEFWQGGEHRLHDRFIYQRNADTWKIDRLAP
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaataatgaatttgatgttgcagatttgcgccgtgaatatattcgtggcggt
ctacgccgcagcgacttaaccgaaaatccattgggattatttgagcgctggttaaaacag
gcttgtgatgcgcgtttacccgatccaacagccatgtgtgtggcgacagtggacgccaac
ggccagccctatcagcggattgtgctgctaaaacattatgacgaccagggtttggtgttc
tataccaacttaggcagtcgcaaagcgcagcaattggcgcaaaacccgcatatcagctta
ttattcccttggcatatgcttgacaggcaagtcatcttccttggcacagcggaacggctt
tccaccctcgaagtgctgaaatatttcagttctcgtcccaaagatagtcagattggtgcc
tgggtatcccagcaatcctcacggatttccgctcgtggtgtattggaaagtaaatttctc
gagcttaagcaaaaattccaacaaggtgatgtgccgctacccagtttttgggggggattc
cgggttaaattcgactctgtcgagttctggcaaggaggcgaacaccgcctgcatgaccga
tttatctatcaacggaatgcagatacctggaaaattgaccgtttagcaccgtga

DBGET integrated database retrieval system