KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2055Help
Entry
YE105_C2055       CDS       T01480                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    YE105_C2055
Enzymes [BR:yep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     YE105_C2055
Transporters [BR:yep02000]
 Other Transporters
  Pores ion channels [TC:1]
   YE105_C2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2367372..2367980)
Genome map
AA seq 202 aa AA seqDB search
MKLFYKPGACSLSPHIVLREAGLDFSIESVDLATKKTETGEDYLHINPKGQVPALLLDDG
SLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFVATELHKGFSPLFNPKTPDE
YKAIARERLDKQFSYVDGVLAKHDYLLGSKFSVADAYLFTVTRWATALKLEIKQRSHLDK
YMARVAERPAVKAALAAEDVKK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttctataaacccggtgcctgctctttgtctccccatattgtgttacgtgaa
gcggggctagacttcagtattgaaagtgtcgatttggcgactaaaaaaactgaaacgggt
gaagactatttgcacatcaacccgaaaggacaagtgcctgctctgctactggatgacgga
agcctgctcactgaaggtgtggctatcgtgcaatatctggcggataaggtgcctgatcgc
cacctgattgcaccatcaggcaccctttcccgttaccacgccattgagtggttaaacttc
gttgcgactgaattacataaaggtttcagcccgctgtttaacccgaaaacaccagacgaa
tataaagctatcgcccgtgaacggctggataagcaattcagctatgtcgatggcgtatta
gcaaagcatgattatctgttaggctcaaaattcagcgtagccgatgcttatctatttacc
gtaacccgctgggcaactgcactgaaacttgaaattaaacagcgcagccatttagataaa
tatatggcgcgggtagcagagcgtccggcagtcaaagcggcgctcgcagcagaagacgtg
aagaaataa

DBGET integrated database retrieval system