KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2058Help
Entry
YE105_C2058       CDS       T01480                                 

Definition
(GenBank) hypothetical protein
  KO
K06996  
uncharacterized protein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2369422..2369775
Genome map
AA seq 117 aa AA seqDB search
MGIQGNDSRIDNIEFAVSDIARSKDFYGTVFDWRFTDYGPSYCEFTDGRLTGGFTLGEVK
PNGGPLVILYADNLERMQKRLEQAGAKIVIPIFAFPGGRRFHFTDTDGYQLAVWSNN
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgggtattcagggaaatgatagtcgtattgataatatagagtttgctgttagtgatatt
gcccgttcaaaagatttttacgggacggtttttgattggcgctttactgattatgggccg
agctattgtgagtttaccgatggtcgattgacgggaggattcactttaggcgaagttaag
cctaatggtgggccacttgtcattctgtatgctgataatttagaacggatgcaaaaacgt
ttggaacaggcgggtgccaagattgttatcccgatatttgctttcccgggtgggcggcgt
ttccacttcaccgatacggatggatatcagttggccgtatggtcaaataactga

DBGET integrated database retrieval system