KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2060Help
Entry
YE105_C2060       CDS       T01480                                 

Definition
(GenBank) LysR family transcriptional regulator
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2372033..2372944
Genome map
AA seq 303 aa AA seqDB search
MCMDIKQLIYLCNLERERHFGRAAEASFVSQPTLSMRLKNLERELGVALINRGNNFKGFT
AEGERVLSWAREIVSVYQGLKLEVESLKNGLNGTLRIGVVPQCSISLARLLKSAGERYPH
LDYRVSVLSADQLLEALTGHSVDVGIGFFELTILNELHFQAQPLVDSGVDVVFHPEHFPE
LIGTEPLTLSQVAALPLCLAEPGRYFRRYLDNSFRDAGLSLHARLESTSIFQLLQGIFVG
LGCGLFPQGSLLAEMSPALLRRPVDIPKMSRHAAVVVAEPGRVTPLAQHFFDVAQEWLTS
HEA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtgtatggatatcaaacagcttatctatctctgtaatttggagcgcgagcggcatttt
ggccgagcggctgaagccagttttgtgagtcagccaacattgtcgatgcgcttgaaaaat
ctggagcgggagctgggtgttgcactcataaaccgtggcaataactttaaaggatttacc
gcagaaggcgaacgagtattatcgtgggcgagagaaattgtctctgtttatcaggggcta
aaattggaagtcgagtcacttaaaaatgggttgaatggcacattacgtattggcgtggtg
ccacaatgtagtatctcattggcacgattactgaagagtgccggcgaacgctatcctcat
ctggactatcgggtctcggtgttaagtgcggatcaattgttggaagcgttaaccggtcat
tcggttgatgtaggtataggtttttttgaactgaccatactcaatgagctgcattttcaa
gctcaaccgctagtcgatagcggggttgatgtggtgtttcatcccgagcattttcctgag
ttgataggcaccgagccactgacactttctcaggtagcagcattgccactgtgtttggcg
gagcctggccgttacttccggcgttatctggataatagtttccgcgatgcagggttatca
ctgcacgctcggctggaaagcacatcgatatttcagttactacaagggatctttgttggg
ttgggctgtggtttattccctcaaggcagtttactggcagagatgtctccagcattactg
cgaaggccggtggatattcctaaaatgagccggcatgctgcggtggtggtggctgagcca
gggcgggtaacaccgctggcccagcacttctttgacgttgcccaagagtggctgacttcc
cacgaggcgtaa

DBGET integrated database retrieval system