KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2063Help
Entry
YE105_C2063       CDS       T01480                                 

Definition
(GenBank) peptide transport system ATP-binding protein
  KO
K19229  
cationic peptide transport system ATP-binding protein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Cationic antimicrobial peptide (CAMP) resistance
ABC transporters
Module
Cationic peptide transport system
Brite
KEGG Orthology (KO) [BR:yep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    YE105_C2063
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    YE105_C2063
Transporters [BR:yep02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Cationic peptide transporter [MD:M00739] [OT]
    YE105_C2063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2375392..2376384)
Genome map
AA seq 330 aa AA seqDB search
MPLLDIRNLTIEFMTAEGMVKAVDRISITLTEGEVRGIVGESGSGKSLIAKAICGVSKDN
WRITADRFRFNDIDLLQLTPRERRKVIGHNISMIFQEPQSCLDPSESIGRQLVQAIPGWT
YKGHWWQRFHWRKRRAIELLHRVGIKDHKDIMGSYPYELTEGECQKVMIAIALANQPRLL
IADEPTNAMEPTTQAQIFRLLARLNQNNNTTILLISHDLQMMSKWATRINVLYCGQTVES
AVCEDLLASPHHPYTQALIRAMPDFGRALPHKSRLNTLPGAIPSLEHLPIGCRLGPRCPY
AQKTCIETPRLRLVKNHAFACHFPLNLEEQ
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgccgttactggatattcgcaacctcaccattgaatttatgaccgccgaagggatggtg
aaggcggttgaccgcatcagtatcacccttacggagggggaagtccgtggaatagtcggc
gaatcaggctcgggcaagagtttgattgccaaggctatctgtggcgtaagcaaagataac
tggcgtattaccgctgaccgttttcgctttaatgatattgacctgttgcagttgacgccc
cgtgagcgacgtaaggtgatcggccataatatttcgatgatttttcaggagccgcaatcc
tgtttggatccgtcagaaagtattggtcggcaactggtgcaagctatacccggttggact
tacaaaggccactggtggcagcgattccattggcgtaaacgtcgggccattgagctgctg
catcgggtggggattaaagaccataaagacattatgggcagctacccttacgaactgacc
gaaggcgaatgccagaaggtgatgattgctattgcgctggccaatcagccccgcttactg
attgccgatgagcccaccaatgcgatggaacccaccactcaggcacaaattttccgttta
ctggcgcggctgaatcaaaacaataacaccacaattttgctcatcagccatgacttacaa
atgatgagtaaatgggccacccggattaatgtgttgtattgcggtcagacggtggaaagt
gcggtttgtgaagacctgctggcttccccacaccatccttatactcaagcgctgatccgc
gccatgcctgactttggccgcgctctgccacacaaaagtcggctgaatactttaccgggg
gcgattccttcattggagcacttgccgattggttgtcgtctggggcctcgttgcccttat
gcccagaaaacctgtatcgaaacaccgcgcttgcgattggtgaaaaaccacgcctttgcc
tgccacttccccttaaatctggaggagcaataa

DBGET integrated database retrieval system