KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2072Help
Entry
YE105_C2072       CDS       T01480                                 

Definition
(GenBank) DNA-binding transcriptional activator PspC
  KO
K03973  
phage shock protein C
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Transcription factors [BR:yep03000]
 Prokaryotic Type
  Other transcription factors
   Others
    YE105_C2072
Prokaryotic defense system [BR:yep02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   PspC-PspB
    YE105_C2072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2384130..2384534
Genome map
AA seq 134 aa AA seqDB search
MGDMFKNSSFKNDSFKNNVLGKKKLYRVPEEGMLKGVCAGLAHYFDIPVRLIRVMVVLSL
FFGLFVFTIAAYIVLTFMLEPAPASSFNEHREATPRQLLDQLEYELGAGEQRLRQVERYV
TSETFGVQSRFRQL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatatgtttaaaaacagttcttttaagaacgattcttttaaaaataatgtatta
ggtaagaaaaaactctatcgcgtgccagaagaaggcatgctcaaaggcgtttgcgccggg
ttagcgcactattttgatattccggtgcggctgattcgtgtgatggtggtgttatcgctg
ttttttggtctgtttgttttcactattgcggcttatatcgtgctgactttcatgttggag
cctgcacccgcatccagttttaatgagcatcgcgaggcaacgccgcgccagcttcttgat
cagcttgagtatgagctgggggcaggggagcaacgtttgcgtcaggtcgagcgctatgtc
acttccgaaacctttggggtgcagagccgttttcgtcagttgtga

DBGET integrated database retrieval system