KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2073Help
Entry
YE105_C2073       CDS       T01480                                 

Definition
(GenBank) Phage shock protein D
  KO
K03971  
phage shock protein D
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2384580..2384819
Genome map
AA seq 79 aa AA seqDB search
MNNNPARSRAGVVLTTLIKIIFSVALTYGPAGAAGFIVRNVSRKPLRWLLLMMLEPMLKR
AMGAAVGQFAKEKHETTAK
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataatcccgcccgaagccgtgcaggtgtagtattaaccacactaattaaaatt
atttttagtgtcgcattgacctatggcccggcaggtgcagcaggttttatcgtcagaaat
gtcagccgtaagcccctgcgctggttgttgctgatgatgttggaaccaatgctaaaacgt
gcaatgggggcggcggtgggtcaatttgccaaggagaagcatgaaacgactgcaaaatga

DBGET integrated database retrieval system