KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2074Help
Entry
YE105_C2074       CDS       T01480                                 

Definition
(GenBank) hypothetical protein
  KO
K06918  
uncharacterized protein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2384800..2386197
Genome map
AA seq 465 aa AA seqDB search
MKRLQNEITSLVNRGMDRHLRLAVTGLSRSGKTAFITSLVNQLLHVHSGARLPLFSAVRE
DRLLGVKRVPQRDLGIQRFTYDEGLASLYGTPPNWPTPTRGVSEIRLALRFRSSDSLLRH
FKETSTLYLEIVDYPGEWLLDLPMLEQDYLSWSRQMTGLLQGERAEWAKTWLTLCQQCDP
LAPADENQLAAIAQAYTDYLIRCKNEGLHFIQPGRFVLPGDMAGAPALQFFPWPDVTDLG
ESRLAQADKHSNLGMLRTRFNYYCNSVVKGFYKEHFVRFDRQIVLVDCLQPLNSGPQAFN
DMRLALTQLMQSFHYGKRTLFRRLFSPCIDKLMFAATKADHVTADQHANLVSLLQQLVQE
AWQNAAFEGISMDCVGLASVQATQSGIVEHQGQKIPALRGNRLTDGAPLTVFPGDVPARL
PGPAFWQQQGFHFDEFRPQAVHVDSPLPHIRLDAVMEFLLGDKLR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactgcaaaatgagattacgtcattggtcaatcgcgggatggataggcatctg
cggttggcagtaaccggcttgagccgcagcgggaaaaccgcctttatcacttctctggtg
aatcaattacttcatgtccacagcggtgcgcgtttgccgctgttttctgctgtgcgcgaa
gatcgtctgcttggtgttaagcgggtgccgcagcgtgatttgggcattcagcgctttact
tacgatgaaggtctggcctctttatacggtacgccgcctaattggccaaccccaacccgt
ggtgttagcgaaattcgtttggctttacgttttcgctccagcgactctctgttgcgccat
tttaaagagacatcaacgctgtatttggaaattgtcgattatccgggtgaatggttgttg
gatttacccatgctggaacaagattatttgagctggtcgcggcagatgactggcttgtta
caaggggagcgcgctgagtgggccaaaacttggctgacgctgtgtcagcagtgcgatcca
ttggccccggccgatgaaaatcaactggcggcgattgctcaggcttatactgattatctg
attcgttgtaaaaatgaaggcctgcatttcattcaaccggggcgttttgtgttgccgggc
gatatggcgggggcgcctgcattgcagttcttcccgtggccggatgtcactgatcttggc
gaatcgcggctggctcaagccgataaacattccaatttgggcatgttgcgcactcgtttt
aactattactgcaactcggtggtgaaaggtttttacaaagaacattttgtgcgttttgac
cggcaaatcgtgctggtagattgcctgcaacccctgaatagcgggccgcaggcgtttaac
gatatgcgcctggcgttgacacaattgatgcagagcttccattacggaaagcgcacgtta
ttccgtcgtttattttctccgtgtattgataagctgatgtttgcggcaaccaaagctgac
catgtgacggccgatcaacacgccaacctggtctccttgctgcaacaattggtgcaggaa
gcctggcaaaatgccgcttttgaagggatcagcatggattgtgtcgggctggcgtcggta
caggcgacacaaagcggcattgttgaacatcaaggacagaaaattcctgcattacgcggc
aatcggctaactgatggtgcgccgctaacggttttccccggtgatgttcccgcgcgttta
cccggccccgcattttggcagcagcaagggtttcattttgatgaattccgtccgcaagcg
gtacatgtcgatagcccattgccccatattcgccttgatgccgtcatggaatttttattg
ggagataaattgcgatga

DBGET integrated database retrieval system