KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2080Help
Entry
YE105_C2080       CDS       T01480                                 

Definition
(GenBank) putative mandelate racemase / muconate lactonizing protein
  KO
K19802  
L-Ala-D/L-Glu epimerase [EC:5.1.1.20]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Enzymes [BR:yep01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.20  L-Ala-D/L-Glu epimerase
     YE105_C2080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2391021..2391992
Genome map
AA seq 323 aa AA seqDB search
MRTLRCYPESWPLHSAFVISRGSRTEAKVVVVEIKEAGIHAFGECTPYPHYRESESSVMA
QIALVATAVEQGVSREGLQQLLPAGAARNAVDCALWQLESLQKQQSLWQLTQTAPVAHIS
MAQTVSIGTPEAMAYSASALVHQGANLLKIKLDDHLIAERLVAIRSAAPEVTLIVDANES
WQPEGLAARCQLLADLGVAMLEQPLPAGNDDSLQNFIHPLPICADESCHTRVNLAGLVGR
YDMVNIKLDKSGGLTEALLLAEQAKSLGFAIMLGCMLCTSRAIRAALPLAPGARFVDLDG
PTWLQHDVDDGLHFSTGAIDLSA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccctgcgttgctatcccgagtcctggcctctacattccgcatttgtgatttcc
cgcggaagccgtaccgaagcaaaagttgtggttgtcgagattaaggaagcgggcattcat
gcttttggtgaatgtactccatatccacattacagagaaagtgaatcttctgtgatggca
cagatagccctggtggccaccgccgttgagcagggtgtttcgcgagagggtttacaacag
ttattgcctgctggggcggcgaggaatgcggtcgattgtgcgttatggcagttggagagt
ttgcagaaacagcagagtttatggcagttgacccaaactgcaccggtcgcccatatatct
atggcccaaactgtcagtatcgggactccggaagcgatggcgtacagtgcgagcgcattg
gtacatcaaggcgctaatttattgaaaataaaactggatgaccacctgattgctgagcgt
ttggtggcaatccgcagcgcggcaccagaagtgacattaattgtagatgccaatgaatcc
tggcagcctgagggtttagccgcgcgttgccagttactggcagatttaggggtggctatg
ttggagcagccattacctgctggaaatgatgattccttgcagaactttattcacccacta
cctatttgtgccgatgagagttgccatactcgcgttaatttggcgggattggttggccgt
tatgacatggtcaacattaaactggataaaagcggtgggttaaccgaagcattgctattg
gccgaacaggcaaaatcgctcggatttgccattatgcttggctgtatgttgtgtacatct
cgcgcaatacgtgctgcattgccactggctccaggtgcccgctttgttgatctggatggc
cctacgtggttgcaacacgatgtcgatgatgggttacatttttcgaccggagccattgat
ttatcggcttaa

DBGET integrated database retrieval system