KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2083Help
Entry
YE105_C2083       CDS       T01480                                 

Definition
(GenBank) zinc transporter
  KO
K16074  
zinc transporter
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Transporters [BR:yep02000]
 Other Transporters
  Pores ion channels [TC:1]
   YE105_C2083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2395005..2396018
Genome map
AA seq 337 aa AA seqDB search
MINAEIEDVVVDVVAGKALQVSDAVYSYQLDGKGGVTSISPDVVATAEQPCWLHLDYTHP
DSAAWLQNTPLLPEVVRDGLAGESVRPKVTRLGDGTMITLRGINFNNDARPDQLVTIRVY
MTDKLIVSTRHRKVYSIDDVLNDLQSGTGPTNSGNWLVEIVDGLTDHTSEFIEDLHDKII
DLEDNLLEQKIPARGQMALLRKQLIVLRRYMAPQRDVFSRLASERLPWMNDDDRRRMQEI
SERLGRGLEDLDSSIARTAVLSDEISSLMADAMNRRTYTMSLLAMVFLPTTFLTGLFGVN
LGGIPGNTDSFGFATFCMMLVVLVLGVAWWLKRSKWL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgctgaaattgaggatgttgtcgtggatgtagtcgcaggaaaagcacttcaa
gtttctgatgccgtttattcttatcaactcgatggtaaagggggcgtaacatcaatcagc
cccgatgttgttgctaccgcagagcagccatgttggctgcacctggattacactcacccg
gacagcgcagcctggttgcaaaataccccgctattgcccgaagttgttcgcgatggtttg
gcgggtgaaagtgtccggccgaaagtgacccgcttgggtgacggcacaatgatcaccctc
agagggattaacttcaataatgatgcccggcctgaccagctagtcactattcgggtttat
atgaccgataagttgattgtctcaacccggcatcgaaaagtttactcgattgatgatgtg
ctcaacgatttacaaagtggcactggcccaaccaacagtggcaattggctggtggagatt
gtcgatggcctgaccgaccataccagtgaatttattgaagacttacacgataaaattatc
gatctcgaagataatttattggagcaaaaaatcccagcgcgcgggcagatggcattgtta
cgtaagcagttgattgtactacggcggtatatggctccccagcgcgatgttttctctcgg
ttagccagtgagcgcttgccgtggatgaatgatgatgatcggcgtcgcatgcaggaaatt
tcagagcgtttgggacggggtttagaagatttagactccagtattgcgcgtactgcggtg
ctgtccgatgaaattagttcattaatggctgatgcgatgaaccggcgcacttataccatg
tcgctgttggctatggtatttttgcccaccacctttttaaccgggctgtttggtgtcaac
cttggtggtattcctgggaataccgactcttttggttttgcgacattttgtatgatgttg
gtggtgttggtgctcggtgttgcatggtggttaaagcgcagtaaatggctctaa

DBGET integrated database retrieval system