KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2084Help
Entry
YE105_C2084       CDS       T01480                                 

Definition
(GenBank) C32 tRNA thiolase
  KO
K14058  
tRNA 2-thiocytidine biosynthesis protein TtcA
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Transfer RNA biogenesis [BR:yep03016]
 Prokaryotic Type
  tRNA modification factors
   Thiolation factors
    YE105_C2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2396338..2397279)
Genome map
AA seq 313 aa AA seqDB search
MQEKQVVNQKEQYDLNKLQKRLRRNVGQAIADFNMIEEGDRVMVCLSGGKDSYTMLDILQ
NLQKSAPINFTLIAVNLDQKQPGFPVDILPAYLDKQGVEYKIVEENTYGIVKEIIPEGKT
TCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKLKGMPPKLMSDDG
KHVVIRPLAYCREKDIERFAVARAYPIIPCNLCGSQPNLQRQVIKDMLRDWDKQYPGRIE
TMFSAMQNVVPSHLNDHKLFDFKNITHNSEIVDGGDLAFDREELPLQPVGWQPEDAEDGA
TQPLVRLDVLEIK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaaacaagtggttaaccaaaaagaacaatacgatttgaacaaattacagaaa
cgcctgcgtcgtaatgtcggccaggcgattgctgattttaatatgattgaagaaggtgat
cgcgtcatggtctgcctgtcagggggcaaagacagctacaccatgttggatattttgcag
aacctgcaaaaaagtgcgccaattaacttcaccctcatcgcggttaatctggatcagaaa
cagccaggcttccctgtagatatcctgcctgcctatctggataagcaaggtgttgaatac
aagattgttgaagagaacacttacgggattgtgaaagagatcattcctgaagggaaaacc
acctgctcactctgttcgcgcctgcgccgtgggattttataccgcaccgccactgaactg
ggagccactaaaatcgcgcttggtcaccatcgcgatgatattctgcaaacgctattcctg
aatatgttctatggcggcaaactgaaaggcatgccacccaaactgatgagcgacgatggc
aaacatgtggttattcgcccactggcctactgtcgcgaaaaagacattgagcgtttcgct
gttgccagagcgtacccaattattccttgtaacttatgcggctcgcaacctaacctgcaa
cgtcaggtgataaaagatatgcttcgtgattgggataaacagtatccggggcggatcgaa
actatgttcagcgccatgcaaaatgtggtgccatcacatttaaatgatcacaagttgttt
gatttcaaaaatatcacccacaatagtgaaattgttgatggcggtgatttggcttttgat
cgtgaagaattgccactacaaccggttggctggcagccggaagatgctgaagatggcgct
acacaaccgctggttcgcctcgacgtactggaaatcaaataa

DBGET integrated database retrieval system