KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2090Help
Entry
YE105_C2090       CDS       T01480                                 

Definition
(GenBank) D-lactate dehydrogenase
  KO
K03778  
D-lactate dehydrogenase [EC:1.1.1.28]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Pyruvate metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YE105_C2090
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.28  D-lactate dehydrogenase
     YE105_C2090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2404204..2405199)
Genome map
AA seq 331 aa AA seqDB search
MMKLAVYSTKQYDRKYLELVNKDFGFELEFFDFLLSPKTAKMAAGCDAVCIFVNDDACRE
TLTELKEVGVEILALRCAGFNNVDLNAAKELGITVVRVPAYSPEAVAEHTVGMMMSLNRR
IHRAYQRTRDANFSLEGLIGFNMHGRTAGIIGTGKIGVATMRILKGFGMRLLAYDPYPSQ
AALDLGAEYVDLKTLYAESDVISLHCPMTPENHHLLNKQSFEQMKDGVMIINTSRGGLID
STAAIDALKQQKIGSLGMDVYENERDLFFEDKSNDVIQDDVFRRLSSCHNVLFTGHQAFL
TEEALTSISNTTMQNIAQLKKGEPCPNIVSA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattagccgtttacagtaccaaacagtatgaccgtaaatacctcgaattggtc
aacaaagattttggctttgaattagagtttttcgattttctgttaagcccaaaaaccgca
aaaatggcggctggctgtgatgcggtttgtattttcgtcaacgatgatgcttgtcgcgaa
acattgacagaattaaaagaagtcggcgttgaaattttggcattacgctgtgccggcttt
aataatgtggatttaaatgcagcgaaagagttggggattacagtggttcgcgttccggcc
tattcacctgaagccgtcgctgaacataccgtcggtatgatgatgagccttaaccgccgt
atccatcgtgcttatcaacgcacccgtgatgccaacttctcgctggaaggcctgattggc
ttcaatatgcatggccgaaccgcggggatcatcggcaccggtaaaattggtgttgcgacc
atgcgcatcttgaaaggttttggtatgcgcttgctagcctatgacccttacccaagccag
gcggcgctggatttgggggctgaatatgtcgacctcaaaaccttatatgccgaatcggat
gttatctcgctgcactgcccgatgacgccagaaaaccaccatttgctcaataagcaatcc
tttgaacaaatgaaagatggcgtaatgatcatcaataccagtcgtggtggtctgattgac
tctacagcggcaatcgatgcactgaaacagcagaaaatcggttcactcggcatggacgtg
tatgaaaatgaacgcgatctattctttgaagacaaatccaatgacgtgattcaggatgat
gtcttccgccgtctgtcttcttgccataatgtgttgtttaccgggcatcaggcattcctg
acagaagaagcgctgaccagtatttctaacaccaccatgcagaatattgcgcaactgaaa
aagggcgagccttgcccgaatattgtttctgcctaa

DBGET integrated database retrieval system