KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2092Help
Entry
YE105_C2092       CDS       T01480                                 

Definition
(GenBank) putative lipoprotein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2408109..2408294
Genome map
AA seq 61 aa AA seqDB search
MTWEPVAILLGIFMLSGCLRLEVATPEKPITINMNVKIEHEIQIRVDKDVENLLKNQSNL
F
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
ttgacatgggaacctgtggcaatcctgctgggcatttttatgctgagtggctgtttgcgc
cttgaagtagcaaccccggaaaaaccgatcacgattaatatgaatgtcaagattgagcat
gaaatccagatcagagttgataaagatgtggaaaatctgcttaaaaatcaatccaaccta
ttttaa

DBGET integrated database retrieval system