KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2100Help
Entry
YE105_C2100       CDS       T01480                                 

Definition
(GenBank) putative carboxypeptidase
  KO
K01299  
carboxypeptidase Taq [EC:3.4.17.19]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Enzymes [BR:yep01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.19  carboxypeptidase Taq
     YE105_C2100
Peptidases [BR:yep01002]
 Metallo Peptidases
  Family M32: carboxypeptidase Taq family
   YE105_C2100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2416800..2418281)
Genome map
AA seq 493 aa AA seqDB search
MTTVYQSLRTTFTRLSRFEHLSAIAGWDMQTMMPPKGNLARSEAMAELNVLQHQILTAKQ
VGEWLKQAEQETLDDIEQANLREMRRHYNNAVLVPEALVEAKSLAGARCEHAWRQQRIAN
DWHGFAENLREVVKLSREEAAIRAQAAGISHYDALLNLYEPGTNSADLDRIFGDLKQWLP
TLLQKVIAKQENEACLIPQGPFDLEKQRQLGLNVMKVLGFDFDGGRVDVSVHPFCGGVPQ
DVRITTRYNEQEFLSALMGIVHETGHARYEQNLPREWLGQPISHARSTAIHESQSLLFEM
QLARSKEFLRVILPLVIQQFGEQPAFDEQNFTALNQRVKTGFIRVDADEVSYPAHVILRY
EIEKALISGEIEVDDIPTLWNEKMQQYLGINTEGNYRYGCMQDIHWTDGAFGYFPTYTLG
AMYAAQLFQTARGAIPELDSNIANGDLSHLFSWLQKNIWQHGSRYSTAELITKATGESLN
PRFFREHLERRYL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgactacagtttatcaatccctgcgcaccacattcacccgcctttcccgttttgagcac
ttatccgccattgctgggtgggatatgcaaacaatgatgccccccaaaggaaatcttgct
cgctcagaggcgatggctgagctaaatgtgctgcaacaccagattctgacggccaaacag
gttggcgagtggttgaaacaagcggaacaagaaactctggatgatattgagcaggcaaat
ctgcgtgagatgcggcggcattacaataatgcggtgttagtaccagaggccttggttgaa
gcaaaatcactagcaggtgctcgatgcgagcacgcatggcgacagcagcgtattgcaaat
gactggcatggttttgctgaaaatctacgtgaagtggtcaagttaagccgtgaagaagcg
gcaattcgggctcaagctgctgggatatcgcactatgacgcattattgaatttatatgag
ccgggaacgaatagtgctgatttggaccgtatctttggcgaccttaaacaatggttaccg
acgttattgcaaaaagtgatcgccaagcaagaaaatgaagcctgcttgataccacaaggg
ccatttgacctggaaaaacagcgtcaacttgggctgaatgtgatgaaagtattgggcttt
gattttgatggtggacgagtcgacgtcagtgtgcacccattctgcggaggtgttcctcag
gatgtacgcattactactcgttataatgaacaagagtttctcagtgcgttaatggggatt
gttcatgaaacgggtcatgcgaggtatgagcaaaatttaccccgtgaatggttgggtcag
cctatatcgcatgcacgctctactgcaattcacgaatcccaaagcttactgtttgaaatg
caattagctcgcagtaaggagtttctacgagtcatcctccctctggttatacagcaattt
ggtgaacaacctgcgtttgatgaacaaaacttcaccgccttgaatcaacgtgtcaagacc
ggttttatccgggttgatgctgatgaggtcagctaccccgcccacgtaattttgcgctat
gaaattgaaaaagcattgattagtggtgaaatcgaggtagatgatatccctacgctgtgg
aatgagaagatgcagcaatatctggggataaacactgaaggaaattatcgctatgggtgt
atgcaagatatccattggacggatggcgcctttggttatttcccaacctatactctgggt
gccatgtatgctgctcaacttttccaaactgcgcgtggtgctatccctgaattagatagc
aatattgccaacggcgatttgagccacctattcagttggttacagaaaaatatctggcaa
cacggaagccgttactcaaccgctgagttgattaccaaagcaaccggtgaatcacttaac
cctcgctttttccgtgagcacttagaacgccgttatttataa

DBGET integrated database retrieval system