KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2107Help
Entry
YE105_C2107       CDS       T01480                                 

Definition
(GenBank) pyridine nucleotide transhydrogenase
  KO
K00325  
NAD(P) transhydrogenase subunit beta [EC:1.6.1.2]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YE105_C2107
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     YE105_C2107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2425989..2427269
Genome map
AA seq 426 aa AA seqDB search
MTGMAIALIATILGPDSGNVAWIIIAMVIGGAIGIYLAKKVEMTEMPELVAILHSFVGLA
AVLVGFNSYLDHGPVVMDAVMVNIHLTEVFLGIFIGAVTFTGSIVAFGKLRGIISSKPLM
LPQRHKLNLVALVVSFLLMIMFVKTDSVALQVVALLLMTVIALAFGWHLVASIGGADMPV
VVSMLNSYSGWAAAAAGFMLSNDLLIVTGALVGSSGAILSYIMCKAMNRSFISVIAGGFG
TDGSSTGDAEEMGEYRETNAEEVAELLKNASSVIITPGYGMAVAQAQYPVAEITAKLQAR
GIKVRFGIHPVAGRLPGHMNVLLAEAKVPYDVVLEMDEINDDFPSTDVVLVIGANDTVNP
AALEDPRSPIAGMPVLEVWKAQNVIAFKRSMNTGYAGVQNPLFFKDNTQMLFGDAKDSVE
AILRAL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggtatggccatcgcgcttattgcgaccattctggggccagactcaggtaacgtt
gcctggattatcatcgcgatggtaattggtggggcaattggtatttatctggcgaagaaa
gtcgaaatgaccgaaatgccggaactggttgccatcttgcacagcttcgtcggtctggcg
gcagttctggtcggctttaacagctatctggatcatggcccggtggtcatggacgcagtg
atggtgaatattcatctgactgaagtgttcctgggtatctttatcggtgcggtgacattt
accggttctattgttgccttcggtaaattacgcgggattatctcatccaaaccgctgatg
ctgccgcaacgccataaactgaacttggtcgcgctggttgtttcattcctgctgatgatt
atgtttgtcaaaacagatagcgtggcgctgcaagtggtcgcactattattgatgaccgtg
attgctttagccttcggttggcatttagttgcctctattggtggtgctgatatgccggtt
gtcgtttcaatgttgaactcctattcaggttgggcggcggcggcggcaggtttcatgctg
agcaacgatttgctgattgtgaccggtgcgttagtcggttcttctggtgcgattctgtcg
tacatcatgtgtaaagcaatgaatcgttcgttcatcagtgtgattgccggtggctttggt
accgatggttcttctaccggcgatgctgaagaaatgggtgagtatcgtgaaaccaatgct
gaggaagtggctgaactgctgaaaaatgccagctctgtcatcatcacccctggttatggt
atggcggttgcgcaggcacagtatccagttgctgaaattacagcaaaactccaggctcgt
gggatcaaagtacgctttggtattcacccagtagcagggcgcttgccaggccatatgaac
gtgttattggctgaagctaaagtgccttacgacgtggtactggagatggacgagatcaat
gatgatttcccaagcactgatgtggtactggtgattggcgctaatgacaccgtaaacccg
gcagcacttgaagatcctcgcagcccgattgcaggcatgcctgtgctggaagtatggaaa
gcgcaaaatgttattgctttcaaacgctcaatgaacaccggttatgctggagttcaaaac
ccattgttcttcaaagacaatactcaaatgttatttggtgatgccaaagacagcgtggaa
gctattttacgcgcgctgtaa

DBGET integrated database retrieval system