KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2112Help
Entry
YE105_C2112       CDS       T01480                                 

Definition
(GenBank) DNA gyrase inhibitor
  KO
K07470  
DNA gyrase inhibitor
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2432141..2432614
Genome map
AA seq 157 aa AA seqDB search
MAFKIIEKQPQQIVSIRVVGPYHETIPKGFDQLSSLYTQYQIPGKDWLALYWDNPETNPP
AELRADVSLSVADDYVLPPELSDHLQLQVIPAGLYAVYHTRVSDDDYAKAWGELYNQHLP
QSGYRPTEGACYEVYLNDGRADGYFDIDIYQSVEKDQ
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggcatttaagataattgaaaaacaaccacaacagattgtgagtatccgagtcgtcggg
ccttatcacgaaaccatcccaaaaggttttgaccaactatcatcactttatacccaatac
caaattccgggaaaagattggttagcgctctactgggataaccctgaaaccaatccgccg
gctgagttgcgagctgatgtctcattatctgttgcggatgattatgtcttgccgccagag
ctcagtgatcatctgcaactacaagtgattcccgctggtttgtatgcggtgtaccacact
cgtgtatcagatgatgattacgccaaagcttggggggaattatataaccagcatctgcca
caaagtggctatcgtccaaccgaaggggcgtgctacgaggtttacctcaatgacggcagg
gctgatggctattttgatatagatatctatcaatccgttgagaaagaccaataa

DBGET integrated database retrieval system