KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2113Help
Entry
YE105_C2113       CDS       T01480                                 

Definition
(GenBank) putative short chain dehydrogenease
  KO
K00059  
3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Fatty acid biosynthesis
Biotin metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of antibiotics
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    YE105_C2113
   01040 Biosynthesis of unsaturated fatty acids
    YE105_C2113
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YE105_C2113
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    YE105_C2113
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     YE105_C2113
Lipid biosynthesis proteins [BR:yep01004]
 Fatty acid synthase
  Component type
   YE105_C2113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2432821..2433561
Genome map
AA seq 246 aa AA seqDB search
MTNTIQQVAIVTGASRGIGAAIAERLAQEGYTVLINYSRADDEAEALVRKIQQAGGNVLS
AKGDISDPAAVAQLFTKAETAFGGVDVLVNNAGIMSLSMVADSDDEHFDRQIAINLKGSF
NGMREAAKRLRNGGRIVNFSTSVVGLKLEKYAVYAATKAAVETMTAILAKELRGRDITVN
AVAPGPTATDLFLNGKSAELIEKMAKMAPLERLGTPGDIAAAVAFLVGKDGGWINGQVLR
ANGGLI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataccattcagcaggtcgcgattgttaccggtgcatcacggggtattggtgcg
gcaatagccgagcgtttggctcaggagggctacaccgtcttaatcaattactctcgggct
gatgatgaagccgaagccttagtgcgtaaaattcaacaggcgggcggcaatgtattgagt
gccaaaggcgatattagcgatcccgccgctgtggctcaattgtttaccaaagctgaaacc
gccttcggtggggttgatgtgttggtcaataatgccggtattatgtcactcagcatggtt
gccgacagcgacgatgaacattttgaccgccaaattgccattaacctgaaagggagcttc
aacggaatgcgagaagcggcgaaacgactcagaaatggcggccgaattgttaatttctca
accagtgttgtgggcttaaagttggaaaagtatgctgtttatgctgccaccaaggctgca
gttgaaacgatgacggcaatactggcaaaagagttgcgaggccgcgatattactgtcaat
gctgtggcaccagggccgaccgcgactgatcttttccttaacggaaaatccgctgaactg
attgaaaaaatggcgaaaatggcacccttagaaagattgggcacaccaggggacattgca
gcggctgtggcatttttggtcggaaaagacggcggctggatcaatgggcaagtgttgcgt
gctaacggtggactgatttaa

DBGET integrated database retrieval system