KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2114Help
Entry
YE105_C2114       CDS       T01480                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YE105_C2114
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    YE105_C2114
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    YE105_C2114
Enzymes [BR:yep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     YE105_C2114
Exosome [BR:yep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YE105_C2114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2433740..2435170
Genome map
AA seq 476 aa AA seqDB search
MQNRVSTLSGIALSTLILSSSLFAPNAIAAATGLYDRSAHGDVTQFGGARRLTEDQTQAL
RDSLSNKTVKNVILLIGDGMGDSEITSARNYGMGAGGFFKGIDALPLTGQYTHYSLDKKT
QKPDYVTDSAASATAWSSGVKTYNGALGVDVFGKDHVTLLELAKKAGKATGNVSTAELQD
ATPAAQFAHVTGRKCYGPEETSEKCSTNALENGGRGSITEQMIEGRADVTLGGGSKSFSQ
LAKAGEWKDKSLRDQALARGYVIVENLDDLNAIKQADQQKPLLGLFSSGNMPVRWQGPKA
SYHGNIDKPPVVCENNAERTQGTPTLAAMTEKAIDLLKTNKNGFFLQVEGASIDKQDHAA
NPCGQFGETVDLDEAVQKALEFARADGNTLVIVTADHAHSSQIIEADAKSPGLTQALTTK
DGAIMAISYGNSEDDSQGHTGTQLRIAAYGPHAANVVGLTDQTDLFFTMRDAMAIK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaccgcgtatccactttgtccggcatagcgttatccaccctgatactgagcagc
tctctgttcgcccccaatgctattgccgccgccaccggtttatacgatcgcagcgcccac
ggtgatgtcactcaatttggtggtgctcgccgtttaactgaagaccaaactcaggctctt
cgtgattcgctgtccaacaaaacggtaaaaaatgtcattttactgattggcgatgggatg
ggtgactcagagataacctcggcacgtaactatggcatgggcgcgggtggtttcttcaaa
gggattgatgcattgccgctgaccggacaatacacgcactattcattagataagaaaaca
cagaaaccagattatgtgactgactcggccgcgtcggctactgcatggtcttcaggtgta
aaaacctataatggcgctctgggtgtcgatgtgttcgggaaagatcacgtcaccttgttg
gaattggctaaaaaagcaggtaaagcgactggcaacgtttcaacagctgaactgcaagat
gcaacgcctgcggcacaatttgctcatgttactggtcgcaaatgttacggcccggaagaa
accagtgagaagtgcagtactaatgcgttggagaatggaggtcgtggttccatcacggag
caaatgattgaagggcgcgccgatgtcaccttgggcggcggctcaaagtcattcagccag
ttggctaaagcgggtgaatggaaagataaatctttgcgtgatcaggcactggctcgtggt
tatgtgattgtcgaaaacctggatgatttgaatgccatcaaacaagcagaccaacaaaaa
ccactgttggggttattcagttctggcaacatgccggtacgttggcaggggccaaaagcc
tcttatcacggcaatatagataagccgcctgtggtttgtgaaaacaatgctgagcgaact
cagggtacgccaaccttggccgccatgaccgaaaaagccattgacctactcaaaaccaac
aaaaatggcttcttcttacaagtcgaaggggcgtcaatcgataaacaagatcacgctgct
aacccttgcggccagtttggcgaaaccgtcgatttggacgaagcagtacaaaaagcattg
gaatttgcccgcgcagatggcaacactctggttatcgtgaccgcagaccatgctcattcc
agtcaaattattgaggctgatgccaaatctccgggcctgacccaagctctaactaccaaa
gatggtgcaataatggctatcagttatggcaactcagaagatgattcccaagggcatacc
ggtacacaattgcgcattgccgcttacggcccacatgctgcgaatgttgttggtctgaca
gaccaaactgacctgttctttaccatgcgcgatgccatggcgattaaataa

DBGET integrated database retrieval system