KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2115Help
Entry
YE105_C2115       CDS       T01480                                 

Definition
putative carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YE105_C2115
Enzymes [BR:yep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     YE105_C2115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2435450..2436379
Genome map
AA seq 309 aa AA seqDB search
MDIAVIGSNMVDLITYIDDMPQVGETLEAPDFEIGCGGKGANQAVAAARLGADVMMITRV
GDDLFAENTIRNLQQAGVDTQHVKAVAGTSSGVAPIFVDKSSHNRILIIKGANNHLLPAD
VDAAANVLKTCQLIILQLEIPLETVYAAIDFARQNNIKVILNPAPASKALDIGYACQCEF
FMPNETELAILTGMPVDSMDNIYRAGRSLLDKGLHNLIITLGHRGSLWMHGEEIHHVPPV
SVHAIDTSGAGDAFIGCFAHEYVLHGDVLKAMEMASAFAAYSVTGKGTQRSYPDASQFID
FLKTLHQGK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcagtcattggctcgaacatggttgatctgattacctatattgatgacatg
ccacaagttggggaaacattagaagcgccagattttgaaatcgggtgcggggggaaaggg
gcaaatcaagcggtcgcagcggccagattaggcgccgatgtcatgatgattacccgggta
ggtgatgatctttttgctgaaaataccattagaaatttgcaacaagcgggggtggatacc
cagcatgttaaagcggtagccggaacttccagtggtgtggccccgatttttgtcgataaa
tcgtcacataatcgcattttgattattaaaggtgccaacaaccatctactaccagcagat
gttgacgccgccgcaaatgtcttaaaaacctgccaactgattatcttacaactcgagatc
ccgctggaaactgtttacgcagccattgattttgcgagacagaataatattaaagttatt
cttaatccggctccagcctccaaagcattggatatcggctacgcctgccaatgcgaattc
tttatgccaaatgaaacagaactggccattttgaccggaatgcccgtagacagcatggat
aatatctatcgggcagggcgtagtttattggataaaggcctacataacctgattattact
ttggggcatcgtggctcgttatggatgcatggcgaagaaattcatcatgttccaccggtc
agtgttcacgccatagataccagcggtgcaggagatgctttcattgggtgttttgctcat
gaatatgtcttgcatggcgatgtattaaaagccatggaaatggcatctgcttttgctgca
tacagtgtcaccggcaaaggaacgcaacgttcttaccctgacgcgtcgcaatttattgat
tttttaaagaccctacaccaaggaaaataa

DBGET integrated database retrieval system