KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2116Help
Entry
YE105_C2116       CDS       T01480                                 

Definition
(GenBank) L-fucose permease
  KO
K02429  
MFS transporter, FHS family, L-fucose permease
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Transporters [BR:yep02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Fucose:H+ symporter (FHS) family [TC:2.A.1.7]
    YE105_C2116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2436381..2437631
Genome map
AA seq 416 aa AA seqDB search
MRLNTVQLPDGYLNKTPLFQFILISCLFPLWGCAASLNDILITQFKSVFALSDFASALVQ
SAFYGGYFLIAIPASLVIKKSSYKVAILIGLTLYIVGCTLFYPASHMATYTMFLAAIFAI
AIGLSFLETAANTYSSMIGHKDYATLRLNISQTFYPIGALMGIVLGKYLVFQEGDSLQNQ
MASMTPEQIHEFRLSMLEHTLEPYNYLIFVLLLVMLLFVITRYPHCKPQGDNNEKVAQPS
LKETLKYLAGNSRFKKGIMAQFLYVGMQVAVWSFTIRLALNLGASNERDASNFMIYSFIC
FFIGKFVANFLMTRFKAEKVLIAYSILGVLTLLYVVCVPNFTAVYAAVFVSVLFGPCWAT
IYAGTLDTVDNKYAEVAGAIIVMSIVGAAVVPALQGFVSDHLGSMQHAFVVSPENQ
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttaataccgttcaactgcccgatggctatttaaataaaacaccattattccag
tttattttgatttcctgtttattccctctttggggatgtgcagccagtctgaatgatatt
ttaattacccaatttaaaagcgtttttgcacttagcgattttgccagtgcactggtacaa
agtgctttttatggtggttattttctgattgcaattcctgcatcattagtgattaaaaaa
agcagttataaagtcgctatattgattgggctaacactttatattgtgggctgtactctg
ttttatccggcctcacatatggcaacctatacgatgtttctggcggctatcttcgccatt
gctattgggttaagtttccttgaaacagccgcgaatacctacagttcaatgattggtcat
aaagattatgcgacgttgcggcttaatatcagccagacgttttatcccattggcgcattg
atggggatcgtgttagggaaatatctggtattccaggaaggcgacagtttacagaatcaa
atggcatcaatgacgccagaacagattcatgaattccgcctcagcatgttagaacacaca
ttagagccttataactatctgatttttgtcctgttattggtcatgctgctttttgtcatt
acccgttatcctcattgcaaaccgcaaggtgacaataatgaaaaagtagctcaaccttca
ttaaaagaaacactgaaatatctggcaggaaacagtcgcttcaaaaaaggcattatggcg
cagttcctctatgtgggaatgcaggttgcggtatggtcctttactattcgtttagcgttg
aatctcggcgcttctaatgagcgagatgcatcaaactttatgatttacagctttatctgc
ttctttattggtaagtttgttgccaacttcctgatgactcgtttcaaagcggagaaagta
ttaatcgcctattccatcttaggggtgttgaccctgttatatgtggtgtgtgtacctaac
tttactgcagtttatgcggcggtatttgtcagtgtcctgttcgggccttgctgggcgact
atttatgctggcactctggataccgtggataataaatatgccgaagttgctggggccatt
attgtcatgtcaattgtgggtgctgctgtcgtaccggcattgcaaggctttgtctctgac
catttgggttcaatgcagcatgctttcgttgtctcccctgaaaatcaatag

DBGET integrated database retrieval system