KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2120Help
Entry
YE105_C2120       CDS       T01480                                 

Definition
(GenBank) acetolactate synthase catalytic subunit
  KO
K01652  
acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Valine, leucine and isoleucine biosynthesis
Butanoate metabolism
C5-Branched dibasic acid metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    YE105_C2120
   01230 Biosynthesis of amino acids
    YE105_C2120
  Carbohydrate metabolism
   00650 Butanoate metabolism
    YE105_C2120
   00660 C5-Branched dibasic acid metabolism
    YE105_C2120
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    YE105_C2120
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    YE105_C2120
Enzymes [BR:yep01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     YE105_C2120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2441946..2443622)
Genome map
AA seq 558 aa AA seqDB search
MRYTGAQLIVRLLEQQGITTVAGIPGGAALPLYDALGQSRTIRHVLARHEQGAGFMAQGM
ARATGQTAVCLASSGPGATNLVTAIADAKLDSIPLVCITGQVSSSMIGTDAFQEVDTYGI
SIPITKHNYLVRDISELTRVIPAAFRIAQSGRPGPVWIDIPKDVQTAEIELDNLPEPGIA
DKSCPIDPIAIAKVAQMINNAARPVLYLGGGIVSSEAHEQAIQLAEQAGLPTTMTLMALG
TMPVDHPLSLGMLGMHAARSTNLIMQQADLLIVLGARFDDRAIGKAEQFCPDASIIHIDI
DPAELGKIRRPHFAMNADIKQVLTHLLPLIETQARSEWRSKVSDMQCEFPFNQPNNENPL
CHYGLIRAAAAALDDETIITTDVGQHQMWVAQAYPLHRPRQWLTSGGLGTMGFGLPAAIG
AALAKPQAKVVCFSGDGSLMMNIQEMATAAEEQLNVKIILMNNQSLGLVHQQQDLLDLFF
GKRIFAADYPYRTNFIHIAEGFGFSTCDLNTASDPYSALHEALNRPGPVLIHALIDVDEK
VYPMVPPGAANIDMIGGE
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatacaggcgcccaattaatagttcgtttgctggaacagcaaggcattaccact
gttgcaggcattccaggtggagccgcgcttccgctgtatgatgctctggggcaaagtcgt
actatccgccatgtcctggcgcggcatgagcaaggcgcaggctttatggctcaaggcatg
gcccgagccacaggacaaactgcggtctgtttggcatccagtggccctggcgccaccaat
ttggtcaccgcaatcgccgatgccaagctcgattcgattccactggtttgcatcaccgga
caagtctcatcctcaatgattggtacggacgcattccaggaagtcgatacctacggcata
tccatccctataaccaaacacaattatctggtacgcgatatcagcgaattgacacgggtc
atcccggcagcatttcgcattgcacaatctggccgtcccggcccggtatggattgatatt
cccaaagatgtacaaacggcggaaatcgagcttgataacctgcctgagccagggatcgcc
gataaatcttgcccgattgaccccattgccattgcgaaagttgcgcaaatgattaacaac
gcagcgcggccagtactctatctcgggggcggaatagtcagttctgaggcgcatgaacaa
gcgatacaactggccgagcaagccggtttgccaaccaccatgacattaatggcattaggt
accatgccggttgaccatccattatcattaggcatgttaggtatgcatgccgcgcgatcc
accaatctcatcatgcaacaagcggatctattgattgtgctcggtgctcgatttgatgat
cgggctatcggaaaagctgaacagttctgccctgatgccagtatcattcatattgatatc
gacccggctgaactgggtaaaattcgccggccacatttcgcgatgaatgcggatatcaag
caggtattaactcacttgctgcccttgatcgaaacacaagcacgcagtgaatggcgtagc
aaggttagcgatatgcagtgcgaattccccttcaatcagcccaacaatgaaaatccattg
tgccactatggtttgattcgtgccgctgccgccgcattggatgacgaaaccatcattacc
accgatgttggccagcatcagatgtgggtggctcaggcctatcctctgcatcgcccccgc
cagtggttaacctccggtgggctaggcactatggggtttggtttgcccgcagcaattggc
gccgcactggccaaaccgcaagcaaaagtggtgtgtttttccggtgatggcagcctgatg
atgaatattcaagagatggcgacggctgcggaagagcaacttaacgttaagattattttg
atgaataaccagtcactcggattagtccatcagcaacaagacctgttagacctgttcttc
ggtaagcgaatttttgccgcagactacccttatcgcactaattttattcatattgcagaa
ggatttggtttctcaacttgtgacctcaataccgccagtgatccttatagcgcattgcat
gaggcattaaatcgccctggcccagtacttattcacgctcttattgatgtagatgaaaaa
gtctatccaatggtgccgccaggtgcggcaaatatcgatatgattggaggtgaataa

DBGET integrated database retrieval system