KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2121Help
Entry
YE105_C2121       CDS       T01480                                 

Definition
(GenBank) Lipoprotein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2444212..2445006
Genome map
AA seq 264 aa AA seqDB search
MHKSLSVVLIAVLAGCGAKNGAHEQVYIDNYTANRITYIIETQVKKTGHSHPGEVINKVS
AEFLGTPYKADMLIGSPTKHEKLVIDFRGLDCFTYLDYVNSLRKAKDTTDFVQQLTSTRY
INSDISFKNRKHFFTDWSHQSPLNAQDVTAKISSHAVTITKFLNQKKDGSEFIPTLGAVK
RNVVYIPAEFINEAVISQLQTGDYIGTYTKIEGLDVTHTGIFIMTPDGPMLRNASSLKKN
MKVVDSPFLQYVKDKHGIIVLRAL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaatcgttatctgtggttttaattgcggtgttagctggctgtggtgcgaaaaat
ggtgctcatgaacaagtctatattgataattacacagctaatcgaatcacttacattata
gagactcaagtcaaaaaaacgggtcatagccatccgggagaagtgattaataaagtttcc
gctgagtttttggggaccccctataaagcagatatgcttattgggtcaccgacaaaacat
gaaaaattagtaatagatttcagaggcctggattgctttacttatcttgattatgttaat
tcgctgcgtaaggctaaagatacaacagactttgtgcagcagcttacgagtactcgctat
attaatagtgatattagcttcaaaaatcgcaaacacttcttcactgactggtcacaccaa
tcgccattgaatgcgcaagatgttactgcaaagataagttctcatgccgtgactatcact
aagttcttgaatcaaaaaaaggatggtagtgaatttattccaacattaggtgccgttaaa
cgaaatgtcgtttatatcccagcagagttcattaatgaagctgttattagccaattacaa
accggcgattacattggtacttataccaaaatagaagggttggatgtcactcataccggt
atttttattatgacacctgatggtccaatgctccgcaatgcctcttcgttgaaaaagaat
atgaaagttgttgattcaccttttctccaatatgttaaagataagcatgggattatcgtg
cttagagcattataa

DBGET integrated database retrieval system