KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2122Help
Entry
YE105_C2122       CDS       T01480                                 

Definition
(GenBank) Negative regulator of beta-lactamase expression
  KO
K01447  
N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Enzymes [BR:yep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     YE105_C2122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2445085..2445861
Genome map
AA seq 258 aa AA seqDB search
MYMIDYNNFRAIKSFNSRVRFLVLHYTAENFENSINSLTGNNVSVHYLVPDLDDDSYKKA
GFNNIRIFNLVDENARAWHAGVSSWAGRANINDTSIGIEIVNLATEHSGVFDFPPYPENQ
IAAVKQLAANILQRYPDISPTHVVAHSDIAPTRKSDPGPKFPWLELYNNGIGAWYDSETK
EKFVQQFTQQGLPTKADLLSYFKTYGYDISIASSDDGYQHLVRAFQLHFRSDNYDGHIDI
ETVAILYALVEKYFPAQN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtatatgattgactataataattttcgtgctatcaaatcatttaattcccgagtgcgc
tttttggtcttacactatacggccgaaaattttgaaaattccatcaattccctaactggc
aataatgttagtgttcattacttagttcccgatcttgatgatgacagttataagaaagcg
ggatttaataacatacgcatatttaacctggtggatgaaaatgcgcgggcttggcatgca
ggagtcagcagttgggcggggcgcgctaatattaatgatacttccatcgggattgaaatt
gtcaacttggccactgagcacagtggtgtttttgattttccaccgtatccagaaaaccag
attgcagcagtaaaacaattggcggccaatatattacagcggtaccctgatatatcccca
acacatgtggtggctcactctgatattgccccgactcgcaagagcgaccctggaccaaag
tttccttggctggagttgtataacaacggtattggtgcctggtatgattcagaaaccaaa
gaaaagttcgttcaacagtttactcagcaagggttaccgaccaaagctgacttactgagc
tacttcaaaacttatggctacgatatttccattgccagtagtgatgatggatatcagcat
ctggtccgtgcatttcagctacactttcggtcagataactacgacggtcatattgatatt
gagacggtggctattctatatgccttggttgaaaaatattttccggcacagaactag

DBGET integrated database retrieval system