KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2127Help
Entry
YE105_C2127       CDS       T01480                                 

Definition
(GenBank) putative inositol-1-monophosphatase
  KO
K01092  
myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Streptomycin biosynthesis
Inositol phosphate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    YE105_C2127
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    YE105_C2127
Enzymes [BR:yep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     YE105_C2127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2454964..2455776)
Genome map
AA seq 270 aa AA seqDB search
MTRLSATDIDSRYQFACDVAKAAGFMAFGFYQQRQELEIQHKGNDLQDVVSMADREVEAL
TRNMIAQRFPMDDFLGEETGGGHANAACTWVVDPIDGTACFLNGLHTWCVSVGVIVDGEP
VIGVVYDPNHQELFHACRGGGAFLNGKPIQVHPGKDVRDGVMGVGTSHRVTPEDFLPFLN
HLLHAGGMFMRSGSGALMTAQVAAGRLIGYYEPHMNAWDSLPGIVLVREAGGITNNFLAD
GGLQKGNVVLMANPQVYQQLTEFVKQPLKS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaccagattaagcgcgacggacattgattcccgctatcaatttgcctgtgatgtcgcg
aaagctgctggctttatggcattcggtttttaccagcaacggcaagagttagagatacaa
cacaaaggcaatgatttgcaggatgtggtcagtatggctgaccgcgaagtcgaagcattg
acccgcaatatgattgcacagcgcttcccaatggatgatttcttgggggaagaaaccggc
ggaggtcatgccaatgccgcttgtacctgggtggttgatccgatagatggaaccgcctgc
ttcctgaatgggctgcatacctggtgtgtttctgtcggtgtgattgtcgatggcgaacct
gttattggtgttgtttacgatcccaatcatcaggaactgttccatgcctgccggggtggc
ggtgcatttctcaatggtaagcctatccaggttcacccgggcaaagatgtacgcgatgga
gtgatgggggttggcacctcacaccgtgtcacgccagaggattttctgccctttctcaac
catctgctacatgccggaggaatgtttatgcgcagcggttccggcgcattgatgaccgcg
caggtggctgccgggcggctgattggctactacgagccccatatgaatgcgtgggacagc
ctgccagggatagttctggtacgtgaagccggtggcataaccaataactttttggctgat
ggcgggctgcaaaaaggcaatgtggtcttaatggccaatccacaggtttatcagcaactg
actgaatttgttaagcaaccactgaagtcatag

DBGET integrated database retrieval system