KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2133Help
Entry
YE105_C2133       CDS       T01480                                 

Definition
(GenBank) hypothetical protein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
2460255..2460800
Genome map
AA seq 181 aa AA seqDB search
MRVVIYQGQYGIFKKNGLDLSMPAIQTCLGLYALSDQHDYLLCAHFDSAFGLQQNLQDIK
RSIELNGIRMSSLRATVFGGDGKQSYLRCSAPSSHIGNEIVNFMKSHGALAQYSNQYYSG
VFPETFNFHYQKGCGITKGQNPRDFLGGSPQAMNLAKQRIKLRPSEYSLTHAKMLDISRL
Y
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgtaatatatcaagggcaatacggcatctttaaaaaaaatgggttagatctg
tcaatgcctgcgatacaaacttgcctagggctttatgctttatcagatcaacacgattat
cttctctgtgcacatttcgattcagcattcggattacaacagaacttacaagatattaaa
cgctccattgaacttaatggcataagaatgagttctcttagagctactgtttttggtgga
gatgggaagcaaagttatttacgatgctctgctcccagcagtcatattggcaatgaaatt
gtcaattttatgaaatcacatggagctttagcacagtattccaatcagtattattctgga
gtttttcctgaaacatttaattttcactaccaaaaaggttgtggcataacaaagggtcaa
aatcccagagatttcttaggtggcagcccgcaggcgatgaatttggcgaagcagagaatc
aaactcagaccttccgagtattcgcttacccatgcaaaaatgttggatatcagccgtcta
tattga

DBGET integrated database retrieval system