KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2136Help
Entry
YE105_C2136       CDS       T01480                                 

Definition
(GenBank) putative hydrolase
  KO
K01482  
dimethylargininase [EC:3.5.3.18]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Enzymes [BR:yep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.18  dimethylargininase
     YE105_C2136
Exosome [BR:yep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YE105_C2136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2463196..2463954
Genome map
AA seq 252 aa AA seqDB search
MHFTQAIARLPADTCGSGQTTSQLGAPDIAATGQQFLAYVDTLLRLGLKVTILPAAPAFP
DAHFVEDTAVVMPELAVITHPGAPSRQGEVDTIEPLFTGRPVFRMSHQGHLDGGDVLLVD
KQFFIGLTSRTDKAGISEFTSAVGRYGYQVTAIEVSAGLHLKSIVNYVGHNTLLLTEDYQ
HHPAFAGFKTIVITDAESYAGNTLWINDTLITPQGYPETLTQIEKLGMPIVQLDTSEFKK
MDGGLTCLSLRF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcattttactcaagccattgccagacttcctgctgacacctgtggtagcggtcagaca
acatcccaattgggcgcgccggatattgctgccaccgggcaacaatttctggcttatgtc
gatactttgctgcgacttggcctgaaagtgactatcttaccggcggctccagcctttccg
gatgcccactttgtcgaagatacggcggtggtgatgccggagctggcggtgataactcac
cccggagcgccaagtcgccaaggcgaagtggacaccattgagccactgttcaccggtcgc
cctgtttttcgcatgagtcatcaggggcatcttgatggcggtgatgtgttattagtcgat
aaacagttctttatcgggctgacgtcgcgcaccgataaagcgggcattagcgagtttact
tctgcggtcgggcgctatggttatcaagtgaccgccattgaagtgagcgccggtctgcac
ctgaaatccattgtgaactacgtgggccacaacaccttgttgctaaccgaagattaccaa
caccatccggcctttgctggctttaaaactattgtgattaccgatgcggagtcttacgcc
ggtaataccttatggatcaatgatacgctgattactccgcaaggttatcctgagaccttg
acgcaaattgaaaagctggggatgcctattgtccagcttgataccagtgaatttaaaaaa
atggatggcggcttgacctgcctctcacttcgtttctga

DBGET integrated database retrieval system