KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2139Help
Entry
YE105_C2139       CDS       T01480                                 

Definition
(GenBank) Polar amino acid ABC transporter, inner membrane subunit
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2465513..2466235
Genome map
AA seq 240 aa AA seqDB search
MNLQTIMEAVPTFLYSDGADMTGLAVTAKLFLLSVVPGLLLALVMAVGQAFGPRPLAWLI
RSVTYFFRSTPLYLQLMLIYYGLSQFDIVQLGWQDDQPFWLLFRDATFCATLALVLNTSA
YVAELLAGMMVTFPRQEWVAGEAFGMSQWQIIRRLVLPATLRRGIPALNNEMVFLLHATS
LASTVTLLDITGVARAFYAATYSPFIPFLMAAALYLLCTFMLIFLFSRAERRWLAFARHD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcaaaccatcatggaagcggtgccgacattcctgtatagcgacggtgctgat
atgaccggtctggcggtgactgccaagttatttttgctgtcagtagtgcccggtttactg
ctggcgctggtgatggctgtcgggcaagcattcggcccacgtccgttggcttggttgatt
cgtagtgtgacttatttctttcgtagcacgccactctacctgcaactcatgctcatctac
tatggcctgtcgcagtttgacattgtgcagttaggctggcaggacgaccaacccttttgg
ctgctgttccgtgatgctactttctgcgccacactagcgttggtgctcaataccagcgct
tatgttgcggagttattggcgggcatgatggtgactttcccgcgtcaggagtgggtggct
ggcgaagcgtttggtatgagtcagtggcaaatcattcgccgtttggtattaccagcgaca
ttacgccgcggtattccggcgttgaataacgaaatggtgttcttgctgcatgcaacctca
ctggccagtaccgtcacattgcttgatatcacgggtgtggcacgggctttctatgcagcc
acttattcgccgtttattccatttctgatggcggctgcgctgtatttgctgtgtaccttt
atgttgatttttttgttttcacgcgcggaacggcgttggttggcctttgcccgccacgat
tga

DBGET integrated database retrieval system