KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2143Help
Entry
YE105_C2143       CDS       T01480                                 

Definition
(GenBank) Membrane-fusion protein
  KO
K01993  
HlyD family secretion protein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2468874..2469974
Genome map
AA seq 366 aa AA seqDB search
MIFLGLLLVGSSLIYFGSRNDAVSVAKSIKSGVLTADEINIAFENVGGKLISRKVQESQQ
VKKGDVLMVLDEVDTDIAIERLKAVIRSQEALIRQEESAIHIATNETTLTEVSSWRKIEE
IQATLSAARASENLARTDFNRIAKLHNTGSVSQSVLDNAKSSLTTTHAAVIQAERQLASA
MIGTTPAQVKNLSEKESAQGMTLQSIANSRESIKNRQNILDQLLAQLDQSHAELRQLEVN
RQRLTLTAPASGKVLKLLYQPGEMIPAGAPAVLLETDRKYVDIYVNENMVTIYQPGTTVT
AQVPALDSQVRGVVRFASAAPSFADLRMTRERGQADLTSYQVRIYTEDKPQLLSGMTLEV
DDAEHR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgatctttttggggctactgcttgtggggtcaagtctcatctattttggctcaagaaat
gatgccgtctcggtggcgaaaagcatcaaatcaggggtgttaacggctgatgaaatcaat
attgcatttgaaaatgtgggcggaaaactaatcagtcgcaaggttcaggaatcccagcag
gtgaaaaaaggggacgtcctgatggtgctggatgaggtcgatactgacattgccattgaa
cgtcttaaggcggttattcgttctcaggaggcattgatccgtcaggaggaatcggctatc
catatcgccaccaatgaaaccacattaaccgaggtttcatcctggcgtaaaattgaagaa
attcaggctacattgagcgctgcccgtgccagtgaaaatctggcgcgcacggatttcaat
cgcattgctaagttgcataataccggtagtgtttcgcaatcggtgctggataatgccaaa
agcagtttgaccacaacccatgctgcagtgatacaagcagagcgtcaattggcttcagcg
atgattggcactacaccagcacaagtgaaaaatctgtcagaaaaagagagtgcgcagggc
atgacgctacagtcaattgctaactcacgcgaatctatcaaaaaccgccagaacattctg
gatcagttactggctcaattagatcaatctcatgcagaactcaggcaacttgaagtcaat
cgtcaacgattgacactgacggcacctgctagcggtaaagtcttaaaactcctttatcaa
cccggtgaaatgatcccggcaggcgcaccggctgtgctgttagaaaccgatcgcaaatac
gttgatatctacgttaatgaaaatatggtcaccatctatcaacctggaaccaccgtcacc
gcacaggttccggcgcttgatagtcaggttcgtggcgtggtgcgatttgccagcgcagca
ccatccttcgctgatctgcgcatgacacgggaacgaggccaggcggatctaacttcctat
caagtgcgtatctataccgaagataaaccacagttactgagcgggatgacacttgaggta
gatgatgcagaacatcgttaa

DBGET integrated database retrieval system