KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2152Help
Entry
YE105_C2152       CDS       T01480                                 

Definition
(GenBank) Bacterial type II and III secretion system protein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2478827..2479723)
Genome map
AA seq 298 aa AA seqDB search
MRSVIVAFLFACSFCVSAETVNLNNSSVRSFVQWYSSKTGKPVIVNPDIKGNVTVFNADV
NPTNIDDFFKSVLNANGFVMLSGNPAVVSLPSKLPSQMVSDSDDSDNQSYDTFPSEPSYQ
PVPVALTVRNFKLTKVRSSDVQQLIKIYLDSNGGGNVVDYPGNNSLIVSAPDELLPVLSD
FINSVDVARDQVLIQSLMFETSLSDGVDLSFAAGSASGHKVAGGFNTSALGSALSTAGGS
FGIFDGNVLALSLRAVQSNSRSKVISTPRILTQSGQTGYISVGKNVPFITGKVTGNWF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcgctctgttattgttgcttttttatttgcctgttcattctgcgtttctgctgaaact
gttaatttaaataattcatctgttcgctcatttgttcagtggtattcttcaaaaactggc
aagcctgttattgttaatcctgatattaaaggaaacgtaaccgtatttaatgctgatgtt
aatccaacaaatattgatgatttctttaagtctgttctgaatgctaacggttttgtcatg
ctttctggcaatcctgcggtagtctctttgccgtctaaattaccttcacagatggtttcg
gattccgatgattctgataaccagtcttatgatacttttccttctgagccatcttaccag
ccagtacctgtggcgcttacggtcagaaattttaagctgacaaaagttagatcgtccgat
gttcagcaactgattaaaatttatcttgattctaatggtggtggtaatgtcgtggattat
ccaggcaataactcgctgattgtttctgcgcctgacgagctgctgccggttctgtccgat
tttatcaattctgtggatgttgcccgcgatcaggttctcattcagtcgctgatgtttgaa
accagcttgtctgatggcgttgatttatcgtttgcggcaggttctgcatccggtcataag
gttgcggggggctttaatacttctgcactgggtagcgctctttctacggcgggcggttct
tttggtatttttgatggtaacgtgttggcgctgtctctgcgtgctgtccagagtaattca
cgctctaaggtgatttcaacgccgcgtattcttactcagtctggtcagactggttacatt
tccgtaggtaagaatgtgccgtttatcaccggaaaggtaacgggcaactggttctga

DBGET integrated database retrieval system