KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2154Help
Entry
YE105_C2154       CDS       T01480                                 

Definition
(GenBank) Coat protein D
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2480826..2481167)
Genome map
AA seq 113 aa AA seqDB search
MPLLLGIPALLRFLIGLVPLFIGYVASFLARLATRTGLIAFALVALITTTVTLLMQYLAE
VMYNGLPADFSHLMASVLPDHFQACVNVIMVTRISVFVFDLKQKFLDYANRVI
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcctttattattaggtattcctgcattgttgcgttttcttattggtcttgttcctttg
tttattggctatgtggcgagttttttagctcgacttgctaccagaacaggattaatcgcc
tttgcattggtcgcattaattacaacaactgttacgcttttaatgcagtaccttgctgag
gtcatgtataacggtttacctgctgatttctcccatttaatggcgtctgtattgcctgac
cattttcaggcgtgtgttaacgttattatggttactcgtatcagtgtttttgttttcgat
ttaaaacaaaaatttcttgattatgcaaacagggtgatttaa

DBGET integrated database retrieval system