KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2159Help
Entry
YE105_C2159       CDS       T01480                                 

Definition
(GenBank) Conserved domain protein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2484503..2484685
Genome map
AA seq 60 aa AA seqDB search
MAKRTTYNVTEERKMKLERLAINASVKLGKTITWTEILGYLIDNYSKDAAEDLMSAKQKD
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgcacgacttataacgtgacggaagaaagaaaaatgaaactagaacgactg
gctataaatgccagtgtaaaactaggaaaaacaattacatggacagagattttaggttat
ctgattgataactactctaaagatgcagcagaagatctcatgtctgccaaacaaaaggat
taa

DBGET integrated database retrieval system