KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2160Help
Entry
YE105_C2160       CDS       T01480                                 

Definition
(GenBank) hypothetical protein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
2484774..2485196
Genome map
AA seq 140 aa AA seqDB search
MSRNNETSGVELVVVGVFAFCLAVVAWLMKTFDVEWQTALETAPGLIVWLLVVGAGIFFG
IKMETGLIRWGAPLAIALLIPVFKPILKEAAGVRETGGLVFDDMVSWYGTGWGMSLMFFG
ILIVGYGLLYWWHRRNSYYW
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaataacgaaacaagcggcgttgaactggttgttgtaggcgtatttgctttc
tgtctggcagttgttgcctggctaatgaaaactttcgatgttgaatggcaaacagcactg
gaaactgcgcctggcctgatagtctggctgcttgttgtcggtgcggggatctttttcggg
atcaaaatggaaactggccttattcgctggggtgctccactggcgatcgcccttctgatt
ccggtattcaagccaattcttaaggaagctgccggagttcgtgaaacgggtgggctggtt
ttcgatgatatggtttcgtggtatggaactggctggggaatgtctctgatgttcttcggg
attcttattgtcggatatggcctgctttattggtggcacagaagaaattcatattactgg
taa

DBGET integrated database retrieval system