KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2166Help
Entry
YE105_C2166       CDS       T01480                                 

Definition
(GenBank) hypothetical protein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zot AAA_18
Motif
Other DBs
NCBI-ProteinID: ADZ42662
Position
complement(2488023..2489117)
Genome map
AA seq 364 aa AA seqDB search
MAVYVVTGKLGSGKTLVSVSRIQERLAKGCPVATNLDLKLHNMPMVGRYAKKTRVIRIPD
KPSLNDLLAIGIGNTSYDESRNGLLVLDECGTWFNSRSWGDKDRQPVIDWFLHARKLGWD
IIFLIQDISIMDKQARLALAEHVVYCRRSDKLNIPFVGSIMNLVSGARFSLPKVHFGIVK
YGDNVNSITVDKWIYTGKSLYSAYNTKQAFTDNYPHGAFSLLPPFITHGQFSVHRGFNYY
MRLTKIYFRKSNRLILMLSFLALGLAFGFWLQSGKNVDEISAIKSAYAEQARAVTPDSSS
DLPRLSINSFSQLGFDVSVTFVDAKGMKYQYFDLIKDGYSVDIKDACRVVIRKGRYLQTV
TCQE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttatgtagtaacaggcaaattaggctcaggcaagacacttgttagtgtttcc
agaatacaggaaagacttgctaagggttgtcctgttgccactaatcttgatcttaaattg
cataatatgcctatggttgggcgttatgcgaaaaaaacgcgcgttattcgcattcctgac
aagccttcattaaatgatttacttgctattggtattgggaatacatcttacgatgaatcc
cgtaatggcctccttgtacttgatgaatgtggtacttggtttaattcccgctcatggggt
gataaagacagacaacctgttattgactggtttttacatgccagaaaattaggctgggat
attatatttttgattcaggatatttcgataatggataagcaagctcgtctggcgcttgct
gagcatgttgtttattgtcgccgttcagataaattaaacattccttttgttggctccatt
atgaatttggtttcaggggcgagattttctttaccaaaggtacactttggcattgtcaaa
tatggtgataatgttaattcaatcactgttgataaatggatatatacaggaaaatctctt
tattctgcttacaataccaaacaagcgttcacagataattatcctcatggcgcattttcg
cttttgccaccatttatcacgcacggtcaattttctgttcacagaggatttaattattat
atgcgcctcactaaaatttattttcgcaaatcgaaccgtcttatattaatgctttctttt
ttggcgctggggcttgcgtttggtttctggctccagtctggaaagaatgttgatgaaatc
tcagctattaaatctgcttatgctgaacaggcgagggcggtaacgcctgattcgtccagt
gacttaccccgactttctattaattctttttcacaacttggctttgacgtttccgttacg
tttgttgatgcaaaaggtatgaaatatcagtattttgatttgattaaagatggttattcc
gttgatattaaagatgcctgtcgtgttgttattagaaaaggccgttatttacagactgtt
acctgtcaggagtaa

DBGET integrated database retrieval system