KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2168Help
Entry
YE105_C2168       CDS       T01480                                 

Definition
(GenBank) Coat protein A
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2489459..2490751)
Genome map
AA seq 430 aa AA seqDB search
MRRKILILSAVLISPFSHAESWESITKSTYQSSAYAESKQITNQDGSKITVYYIDAAMQA
SACQGAKSSAQSVFTRIKPTYEGIWPDSEFRLVFTGDCTYSDSPGQKDKYWSLTAYIVGN
IQRSVPDEKPTDPTPEEICEAKPPEEGVFNNVDSYDGGRYIYYNGCEYEATGVIVCQGDG
TVCAATWKPTGAVADPSDKPSTPQNGGGESGGGESGGGESGGGESGGGESGGGESGGGES
GGGSSGGSSGGGSSGSSLSKGDIQSAIEGASPKIASDIHDKLTEKDTSSDDKKNADEQTR
NNINRLDDSINNLTRGAGRFADPSGGDSRYGKGDSELDGASTLADSELGIEKDSHGALWE
AFLNKGAMLPNLPNGNGCSDFIIFPGEVYQIDIGCDKLLTIKDVLSWVFYCLTFWYVFTS
LTSLLRKGGE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggaaaatattaattctttccgctgtcctcatttctcctttttcacatgctgag
tcatgggaaagcattactaaatccacttatcaaagttctgcctatgctgaaagtaagcaa
ataaccaatcaggatggctctaagataacggtttactatattgatgctgctatgcaggcc
tccgcttgtcagggtgctaaatccagtgctcagagtgtatttactcggattaaaccaact
tatgagggtatctggcctgattctgaattccgtcttgtttttactggcgattgtacttac
agcgattcaccagggcagaaggataaatattggtctttaacggcttatattgttggtaat
attcagcgttctgttcctgatgaaaaacctactgacccgacaccagaagaaatttgtgaa
gcgaagccgccagaagaaggtgtatttaataatgttgattcatatgatggtggtcgctat
atctactataacggctgtgaatatgaggctactggtgtcattgtttgtcagggtgatggt
actgtttgcgctgcaacatggaagcctacaggtgctgtagctgacccctctgataaaccc
tcaaccccccaaaatggtggtggtgagtctggcggtggtgagtccggcggtggtgagtcc
ggcggtggtgagtccggtggtggtgagtccggtggtggtgagtctggcggtggtgagtcc
ggtggcggtagttctggcggtagttctggcggtggctctagtggttccagtctttctaaa
ggtgatattcagtctgcgatcgaaggtgcttcacccaaaatagccagcgatattcatgat
aaattaacggagaaagacacttcatcagatgataaaaaaaatgccgatgaacaaaccagg
aataatataaatcgtcttgacgattccattaacaatcttacgcggggggctggccgtttt
gctgacccttcaggtggtgattctcgttatggaaagggcgactctgaattagatggcgct
tctactttagctgattctgaattgggaattgaaaaggattctcacggtgctttatgggaa
gcatttttaaataaaggtgctatgctgcctaatttacccaatggtaacggctgctctgat
tttattatttttcccggagaggtttatcagattgatattggttgcgataaattactgact
attaaagatgttctttcatgggttttttattgccttacgttctggtatgtctttacttct
ttaacttcattgcttcgcaaagggggtgagtga

DBGET integrated database retrieval system