KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2258Help
Entry
YE105_C2258       CDS       T01480                                 

Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YE105_C2258
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YE105_C2258
Enzymes [BR:yep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     YE105_C2258
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     YE105_C2258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2593251..2594627
Genome map
AA seq 458 aa AA seqDB search
MQDSGLNKTVLHQIVRDKEIWVAARKLQQPLASFQNDITLSRRDFYQTLQGNKTVFILEC
KKASPSKGVIRDNFNPAEIAAVYKNYASAISVLTDEKYFQGNFDFLPQVSAAVTQPVLCK
DFIIDAYQIQLARFYQADAILLMLSVLDDETYRQLAAVAHSLNMGVLTEASNAEELDRAI
ALEAKVVGINNRDLRDLSIDLNRTRELAPRLPKGVTVISESGINNYRQVRELSHFANGFL
IGSALMSETDLNAAVRRVLLGENKVCGLTRAQDAATAYQAGAVYGGLIFVGNSPRYVDIA
QARTVISGAPLKYVGVFRDAKVETIQQTAERLSLSAVQLHGHEDQRYINQLREVLPASCQ
IWKALSVTDTVPVRHLQHVERYVLDNGNGGTGQSFDWSLLAGQPLDNVLLAGGLGPNNCG
TAAQLGCAGLDLNSGVESAPGVKDPQKVAAVFQTLRTY
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcaggattctgggcttaacaaaacggtacttcaccaaatagtgcgcgataaggaaatc
tgggttgccgcgcggaaattacaacagcctctggccagtttccaaaatgacattaccttg
agtcggcgcgacttttatcagacgttacagggcaacaaaacggtgtttattctggagtgc
aagaaagcatcgccgtccaaaggcgttattcgcgataattttaatccagcagagattgct
gctgtttataagaattatgcctcggctatctcggtactgacggatgaaaaatactttcag
ggcaattttgacttcttaccacaagtcagcgcggcggtaactcaacccgtattgtgcaaa
gattttattattgatgcctaccaaattcagcttgcgcgtttttatcaggctgacgctatt
ttgctgatgctatctgtgcttgatgatgagacttaccgccaactggccgccgtggctcat
agcctgaacatgggggtattgacggaggcaagcaacgccgaggagctggatcgcgctatt
gcattagaggcaaaagtcgttggtatcaataaccgtgacttacgtgatttgtctatcgac
cttaatcgcacccgcgaactggcaccgcgcctgcccaagggcgtgacggttatcagcgaa
tcaggcatcaataactatcggcaggtgcgcgaactcagccactttgccaacgggttcctc
attggcagcgcattgatgtctgaaactgacctgaatgcggcggtgcgccgcgtgctattg
ggggaaaataaggtctgcggtctgacccgtgcccaagatgccgctaccgcttaccaggcc
ggggcagtctatggtggtttgatttttgtcggcaactcgccacgttatgtggatattgcg
caggcccgcaccgttatcagtggtgcaccgctgaaatatgttggcgtattccgtgatgca
aaagtcgaaaccatacaacaaactgctgaacggctgtcgctaagtgccgtgcaattacat
gggcatgaagatcaacgctatatcaaccaactgcgcgaagtattgcctgccagttgccag
atttggaaggcattgagtgtcactgacaccgtgccagttcgtcacttacagcacgttgaa
cgctatgttttagataatggcaacggcggcaccggccagagttttgactggtcattatta
gccggtcagccattggataacgtgctgctggcgggtgggctggggccgaataactgcggt
actgcggcgcaattaggctgcgctggtctggatctcaattccggtgtcgaaagcgccccc
ggagtgaaagatccccaaaaagttgccgccgtattccaaacattacgcacttactaa

DBGET integrated database retrieval system