KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2259Help
Entry
YE105_C2259       CDS       T01480                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YE105_C2259
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YE105_C2259
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YE105_C2259
Enzymes [BR:yep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YE105_C2259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2594827..2596017
Genome map
AA seq 396 aa AA seqDB search
MTTLNPYFGEFGGMYVPQILMPALKQLEEAFVSAQLDPAFQAEFQDLLKNYAGRPTALTL
CQNLTEGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGSY
ETAHYMLGTAAGPHPYPTIVREFQRMIGEETKVQLLAREGRLPDTVLACIGGGSNAIGMF
ADFIDEPGVGLIGVEPAGLGIETGQHGAPLKHGKVGIYFGMKSPMMQTSDGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRADYVSVTDDEALDAFKALSCKEGIIPALESSHALAHALKM
IKAEPEKEQILVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccacattaaatccttactttggcgagttcgggggaatgtatgtaccccagattctg
atgccagcattgaaacaactggaagaagcttttgttagtgcacaactggatcctgcattt
caggcggaatttcaggatttattaaagaactatgctgggcgtccaaccgctctgaccctg
tgtcaaaatctgaccgagggaaccaaaaccaagttatatctgaaacgtgaagacttgtta
cacggtggcgcgcacaagactaatcaggttttaggccaggctttattagccaagcgcatg
ggtaaaacagaaatcattgctgaaactggtgcgggtcagcatggtgtagcttcagcatta
gcctgtgccctattgggcttaaaatgtcgtatctatatgggtgccaaagacattgagcgt
cagtcgccaaacgttttccgtatgcgcctgatgggggctgaagttatcccggttcacagc
ggttcatcaacgctgaaagatgcgtgtaatgaagccctgcgtgattggtctggaagctac
gaaaccgcccactatatgctgggaactgccgcaggcccgcacccttaccccactattgtg
cgtgaattccagcgtatgattggcgaagaaaccaaagtgcaactgttggcccgagaaggc
cgcctgcccgatacggtgctggcatgcatcggtggcggttctaacgccattggcatgttt
gctgactttatcgatgagccgggtgtagggctgattggcgtggaaccggctgggttgggt
atcgaaaccggtcaacatggtgctccactaaaacatggcaaagtgggtatctacttcggt
atgaaatcaccgatgatgcaaaccagtgatggtcaaattgaagaatcttactcaatttct
gccggtttagacttcccatctgtcgggccacaacatgcttatttgaatagcatcggacgc
gctgattatgtatcagtgactgatgatgaagctctggatgcgtttaaagcgctgtcatgc
aaagaagggatcattccggcgttggagtcttcccatgcattggcccatgccctgaaaatg
attaaagcagagccggaaaaagaacagatattggtggtgaatttgtccgggcggggtgat
aaagatattttcacagttcacgatattctgaaagcgcggggagaaatttaa

DBGET integrated database retrieval system