KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2260Help
Entry
YE105_C2260       CDS       T01480                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YE105_C2260
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YE105_C2260
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YE105_C2260
Enzymes [BR:yep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YE105_C2260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2596017..2596823
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFKQLAAKKEGAFVPFVQLGDPTPALSLEIIDTLITAGADALELGIPFSDPLAD
GPTIQNAALRAFAAGVTPSICFEMLAEIRKKHPTIPIGLLMYANLVFHNGIDTFYQRCAD
VGVDSVLIADVPFEESLPFRTAALRHGIAPIFICPPNADDDLLREIASHGRGYTYLLSRA
GVTGAENHGQLPLNHLIDKLCEYNAAPALQGFGISEPEQVKISLAAGAAGAISGSAIVKI
IENNVSQPAEMLAQLANFVTNMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatcaacagcttttcaaacagttggctgccaaaaaagaaggcgcatttgta
cctttcgtgcaactcggcgacccaacaccggctctctccttagaaattatcgacactttg
attaccgcaggtgctgatgcattggagttgggcattcctttctctgatccattggctgat
ggcccgacgattcaaaacgccgcactacgtgctttcgccgctggtgttaccccaagtatc
tgttttgagatgctggcagaaatccgtaaaaagcaccctaccattcccattgggttgctg
atgtatgcaaatctggtattccataacgggatagatactttctaccagcgctgcgctgat
gtcggtgtcgactcggtgctgattgctgatgtaccgtttgaagagtccctaccgttccgt
actgcggccttacgccacgggattgcgcctatctttatctgcccgcctaatgcagatgat
gatttattgcgagaaatagcctctcatggccgtggctatacctacctgctctcccgcgcg
ggtgtgacgggggctgagaatcacggacagctgccattgaatcatttgatagataaattg
tgtgaatacaatgcggctccagctctacaaggttttggtatctcagaacctgaacaggta
aaaatcagtctggcagctggggcagcaggtgccatttcaggttctgctattgtaaaaatc
attgaaaacaatgtctcacagcccgcagagatgctcgcgcaattagccaacttcgtgacc
aatatgaaagcagccactcgcagctag

DBGET integrated database retrieval system